KEGG   Homo sapiens (human): 84142
Entry
84142             CDS       T01001                                 
Symbol
ABRAXAS1, ABRA1, CCDC98, FAM175A
Name
(RefSeq) abraxas 1, BRCA1 A complex subunit
  KO
K20774  BRCA1-A complex subunit Abraxas
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    84142 (ABRAXAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    84142 (ABRAXAS1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-A complex
     84142 (ABRAXAS1)
SSDB
Motif
Pfam: HMMR_C Cluap1 DUF2096 EzrA DUF16 DUF948 DUF5798
Other DBs
NCBI-GeneID: 84142
NCBI-ProteinID: NP_620775
OMIM: 611143
HGNC: 25829
Ensembl: ENSG00000163322
Pharos: Q6UWZ7(Tbio)
UniProt: Q6UWZ7
Structure
LinkDB
Position
4:complement(83459517..83485100)
AA seq 409 aa
MEGESTSAVLSGFVLGALAFQHLNTDSDTEGFLLGEVKGEAKNSITDSQMDDVEVVYTID
IQKYIPCYQLFSFYNSSGEVNEQALKKILSNVKKNVVGWYKFRRHSDQIMTFRERLLHKN
LQEHFSNQDLVFLLLTPSIITESCSTHRLEHSLYKPQKGLFHRVPLVVANLGMSEQLGYK
TVSGSCMSTGFSRAVQTHSSKFFEEDGSLKEVHKINEMYASLQEELKSICKKVEDSEQAV
DKLVKDVNRLKREIEKRRGAQIQAAREKNIQKDPQENIFLCQALRTFFPNSEFLHSCVMS
LKNRHVSKSSCNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKALDLDDRWQFKRS
RLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPTF
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggagggggagagtacgtcggcggtgctctcgggctttgtgctcggcgcactcgctttc
cagcacctcaacacggactcggacacggaaggttttcttcttggggaagtaaaaggtgaa
gccaagaacagcattactgattcccaaatggatgatgttgaagttgtttatacaattgac
attcagaaatatattccatgctatcagctttttagcttttataattcttcaggcgaagta
aatgagcaagcactgaagaaaatattatcaaatgtcaaaaagaatgtggtaggttggtac
aaattccgtcgtcattcagatcagatcatgacgtttagagagaggctgcttcacaaaaac
ttgcaggagcatttttcaaaccaagaccttgtttttctgctattaacaccaagtataata
acagaaagctgctctactcatcgactggaacattccttatataaacctcaaaaaggactt
tttcacagggtacctttagtggttgccaatctgggcatgtctgaacaactgggttataaa
actgtatcaggttcctgtatgtccactggttttagccgagcagtacaaacacacagctct
aaattttttgaagaagatggatccttaaaggaggtacataagataaatgaaatgtatgct
tcattacaagaggaattaaagagtatatgcaaaaaagtggaagacagtgaacaagcagta
gataaactagtaaaggatgtaaacagattaaaacgagaaattgagaaaaggagaggagca
cagattcaggcagcaagagagaagaacatccaaaaagaccctcaggagaacatttttctt
tgtcaggcattacggaccttttttccaaattctgaatttcttcattcatgtgttatgtct
ttaaaaaatagacatgtttctaaaagtagctgtaactacaaccaccatctcgatgtagta
gacaatctgaccttaatggtagaacacactgacattcctgaagctagtccagctagtaca
ccacaaatcattaagcataaagccttagacttagatgacagatggcaattcaagagatct
cggttgttagatacacaagacaaacgatctaaagcagatactggtagtagtaaccaagat
aaagcatccaaaatgagcagcccagaaacagatgaagaaattgaaaagatgaagggtttt
ggtgaatattcacggtctcctacattttga

DBGET integrated database retrieval system