KEGG   Homo sapiens (human): 8449
Entry
8449              CDS       T01001                                 
Symbol
DHX16, DBP2, DDX16, NMOAS, PRO2014, PRP8, PRPF2, Prp2
Name
(RefSeq) DEAH-box helicase 16
  KO
K12813  pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    8449 (DHX16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    8449 (DHX16)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     8449 (DHX16)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    8449 (DHX16)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    8449 (DHX16)
SSDB
Motif
Pfam: OB_NTP_bind HA2 Helicase_C DEAD AAA_30 AAA_22 AAA_19 SecA_DEAD SRP54 Flavi_DEAD
Other DBs
NCBI-GeneID: 8449
NCBI-ProteinID: NP_003578
OMIM: 603405
HGNC: 2739
Ensembl: ENSG00000204560
Pharos: O60231(Tbio)
UniProt: O60231 Q5SQH4
Structure
LinkDB
Position
6:complement(30653127..30673006)
AA seq 1041 aa
MATPAGLERWVQDELHSVLGLSERHVAQFLIGTAQRCTSAEEFVQRLRDTDTLDLSGPAR
DFALRLWNKVPRKAVVEKPARAAEREARALLEKNRSYRLLEDSEESSEETVSRAGSSLQK
KRKKRKHLRKKREEEEEEEASEKGKKKTGGSKQQTEKPESEDEWERTERERLQDLEERDA
FAERVRQRDKDRTRNVLERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKRER
EKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEKLEATNRYHM
PKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEE
ETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLII
EGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYS
IRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVA
RFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVL
QIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIF
QPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASAN
QRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDF
LDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEI
LTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYE
NFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYR
TVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKE
LEDPHAKKMPKKIGKTREELG
NT seq 3126 nt   +upstreamnt  +downstreamnt
atggcgacgccggcgggtctggagcgctgggttcaggacgagctgcactcggtgttgggg
ctgagcgagcggcacgtcgcccagtttctgatcggtaccgcacagcgctgcacctctgcc
gaggagttcgtgcagcgcctacgagacactgataccttggatctcagtgggccggcccgg
gacttcgccctgagactctggaacaaggtaccacgaaaggcagtggtagaaaagccagct
cgggcagcagagcgagaggcccgggccctgctggagaagaaccgatcttataggttactg
gaagacagtgaagagagcagtgaggagactgtgagtagggctggaagcagcctccagaag
aaacgtaaaaagcggaaacacctcaggaagaagcgtgaggaagaagaggaggaagaggct
tctgagaaagggaagaagaaaacaggggggagtaaacagcagacagagaagccagagtcg
gaagatgagtgggaacggacagagcgtgaacgccttcaggacctggaggagcgtgatgcc
tttgctgagcgggttcgacagcgggacaaggatcggactcgaaatgtcctggaacggtca
gacaagaaggcttatgaagaggctcagaagcgcctcaagatggccgaggaagaccggaag
gccatggtccctgagctgcggaagaaatctcgccgagagtacctggctaagcgggagcga
gagaagcttgaggacctggaggcggagctggctgatgaggagttcctttttggggacgtg
gagctgagccggcacgagcggcaggagctcaaatataagcggcgagtgcgggatctcgcc
cgggagtaccgggcagctggggagcaggagaagctggaggccaccaatcgctaccacatg
cccaaggaaacccgaggacagccagcccgagctgtggatctagtggaggaggaatcagga
gcccctggggaggagcagcggcgctgggaggaggcgcggcttggggcagcgtccctgaag
tttggggcccgagatgctgcctctcaggagcccaagtatcaactggtgctggaggaggag
gagaccattgagtttgtccgggccactcagctccagggtgatgaggagccgtcagctcca
cccacttcaactcaggcccagcagaaagagtccatccaggccgtccgccgcagcctcccg
gtgttcccatttcgagaggagctcctggctgctattgcaaatcaccaagtcctcatcatt
gaaggcgagacaggctcagggaagaccacccagatcccgcagtatctctttgaggagggt
tatacaaacaagggtatgaagattgcctgcacccaaccccggagagtggctgccatgagt
gtggccgcccgagtggcccgggagatgggtgtgaagcttgggaatgaggttggctacagc
atccgctttgaggactgcacatcagagcgaactgtcctccgctacatgacagatgggatg
cttctccgggagttcctctctgagcctgacctggcgagttacagcgtggtgatggtggat
gaggcacacgaaaggaccctacacacagacattctctttggattgatcaaggatgttgct
cgcttccgacctgagctcaaggtcctggtggcttcagccacaatggacactgcccgtttt
tccaccttctttgatgacgcccctgtgtttcgaatccccggacgcaggtttcctgtggac
atcttctacaccaaggctccagaggctgactacttggaagcttgtgtagtatctgtgttg
cagatccatgtgacccagccccctggggatatcctggtgttcctgacaggacaggaggag
attgaggctgcctgtgagatgctccaggatcgctgccgccgcctgggctccaaaatccgg
gagctcctggtgctgcccatttatgccaatctgccctctgacatgcaggcccgtatcttc
cagcccacaccacctggggcacgaaaggtggttgtggcaacgaacattgctgagacatca
ctcaccattgagggcatcatttatgtgctggatccagggttctgtaagcagaagagctac
aacccccgcacaggcatggaatcgctcactgtcacaccctgcagcaaggcctcagccaat
cagcgagctggcagggcaggtcgggtggctgcagggaagtgcttccgcctgtataccgcc
tgggcctatcagcacgagcttgaggaaaccacagtgcctgagatccagaggaccagcttg
ggcaatgtcgtgttgctgctcaagagcttagggatccatgacctaatgcactttgatttc
ctggaccctccaccatatgagacactgctgctggctttggagcagctgtatgctctggga
gccctcaaccaccttggggagctcaccacgtctggtcgaaagatggcagagctgccggtg
gaccccatgctgtccaaaatgatcttagcctctgagaagtacagctgttcagaggagatc
ctgacagtggctgccatgctctctgtcaacaactccatcttctaccgaccaaaggacaag
gtcgtccatgctgacaatgcccgtgtcaacttctttctccctggcggtgaccacctggtt
ctgctaaatgtttacacacagtgggctgagagtggttactcttcccagtggtgctatgag
aactttgtacagttcagatcgatgcgccgagcccgggatgtgcgggaacagctggaaggg
ctcttggaacgtgtggaagttggtctcagttcctgccagggggactatatccgtgtacgc
aaggccatcactgctggttacttttaccacacggcacggttgactcggagtggctaccgc
acagtgaaacagcagcagacagtcttcattcatcccaactcctccctctttgagcaacag
ccacgctggctgctctaccacgaacttgtcttgaccaccaaagagttcatgagacaggta
ctggagattgagagcagttggcttctggaggtggctccccattattataaggccaaggag
ctagaagatccccatgctaagaaaatgcccaaaaaaataggcaaaacacgagaagagcta
gggtaa

DBGET integrated database retrieval system