KEGG   Homo sapiens (human): 8452
Entry
8452              CDS       T01001                                 

Gene name
CUL3, CUL-3, NEDAUS, PHA2E
Definition
(RefSeq) cullin 3
  KO
K03869  cullin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04340  Hedgehog signaling pathway
Disease
H00243  Hyperkalemic distal renal tubular acidosis (RTA type 4)
H02310  Renal tubular acidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8452 (CUL3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    8452 (CUL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8452 (CUL3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8452 (CUL3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     8452 (CUL3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     8452 (CUL3)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 RhgB_N Phage_antitermQ
Other DBs
NCBI-GeneID: 8452
NCBI-ProteinID: NP_003581
OMIM: 603136
HGNC: 2553
Ensembl: ENSG00000036257
Vega: OTTHUMG00000133167
Pharos: Q13618(Tbio)
UniProt: Q13618 A0A024R475
LinkDB
Structure
PDB: 

Position
2q36.2
AA seq 768 aa
MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRN
AYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIR
DILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDR
GAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEAR
INEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMY
KLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESF
NNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFR
FMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSIS
NTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYL
AKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMT
ILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFT
VNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHN
VLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgtcgaatctgagcaaaggcacgggcagccggaaggacaccaagatgcggatccgggcc
tttccgatgaccatggatgaaaaatatgtaaacagcatttgggaccttctgaaaaatgca
attcaagaaatccagcgtaagaataacagtggtcttagttttgaggagctctatagaaat
gcatatacaatggttttgcataaacatggagaaaagctctacactggactaagagaagtt
gttaccgaacatctcataaataaggtgcgagaagatgtactaaattcattgaataacaac
tttcttcaaacgctaaatcaagcttggaatgatcatcaaacagctatggtgatgattaga
gacatactaatgtacatggaccgtgtgtatgtacaacaaaataatgtggagaacgtctac
aatttgggattaattatttttcgagatcaagttgtacgttatgggtgtattagggatcat
ctacggcaaactctattggatatgattgcaagagagcggaaaggagaagtcgtagacaga
ggcgcaataagaaatgcttgccagatgttaatgattttaggtctcgaaggaagatcagtc
tatgaagaagattttgaggctccttttttggaaatgtctgcagaattttttcagatggaa
agccagaaatttttagcagaaaatagtgcttcagtatatataaagaaagtagaagctaga
attaatgaagaaatagaacgagtgatgcactgccttgacaaatcaacggaagaaccaatt
gtaaaggtggttgaaagggaactcatttccaagcacatgaagactatagtagaaatggag
aattctgggctagtacatatgttgaaaaatggaaagacagaagaccttggttgcatgtac
aagttatttagtcgtgtgccaaatggtttgaaaacaatgtgtgagtgtatgagttcctat
ttgagggagcaaggtaaagctcttgtttctgaagaaggagaaggaaagaatcctgttgac
tatatccagggcttattggatctgaagagtaggttcgatcgcttcctcctggaatcattc
aacaatgaccgtctctttaaacaaactattgcgggtgactttgagtattttctcaacctc
aactccaggtctcctgaatacctctcattatttattgatgataagctgaaaaagggagtc
aaagggctaacagaacaagaagtagaaacaatattggataaagcaatggtcctttttagg
tttatgcaagaaaaagatgtatttgaacgttattataaacaacacttggcaaggagactt
ctcacaaataaaagtgtttctgatgactctgaaaaaaacatgatatctaagttaaagact
gaatgtggatgtcagttcacgtcaaaactggaaggaatgtttagggatatgagcatctca
aacacaacgatggatgaattcaggcaacatctacaggcaactggtgtatctttaggtggt
gttgatcttacagtccgggtgctcacgacaggatattggcccactcagtcagccacacca
aagtgcaacatcccaccagcaccaagacatgcttttgagatattcagaaggttctactta
gccaaacacagtggtcgacagctcacactccagcatcatatgggttctgcagatctcaat
gccacattttatggaccagttaaaaaggaagatggatctgaagttggtgttggaggtgca
caagtaactggctctaatacacggaagcacatattgcaagtttccactttccagatgacc
atattaatgctctttaataatagagaaaaatacacatttgaggaaattcagcaagagaca
gatatccctgaaagagagcttgttagagccctacagtccctcgcctgtggtaaaccaaca
cagcgggttcttacaaaagaacccaaatcaaaggaaatagaaaatggtcatatatttaca
gttaatgatcaattcacatccaaactacacagagtcaagattcaaacagttgctgccaaa
caaggtgaatccgacccagagaggaaagaaacaaggcagaaagtagacgacgacagaaaa
catgagatagaagctgctatagtgcggataatgaaatctagaaagaagatgcagcacaat
gttctagtagcggaggtaactcagcagttgaaggcgcgattcttaccaagtccagttgtt
attaagaaacgtattgaaggacttattgagagagaatatttggcacgaacacctgaggat
cgcaaagtatacacatatgtagcataa

DBGET integrated database retrieval system