KEGG   Homo sapiens (human): 859
Entry
859               CDS       T01001                                 
Symbol
CAV3, LGMD1C, LQT9, MPDT, RMD2, VIP-21, VIP21
Name
(RefSeq) caveolin 3
  KO
K12959  caveolin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04510  Focal adhesion
hsa05020  Prion disease
hsa05100  Bacterial invasion of epithelial cells
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06415  PI3K signaling
nt06465  Prion disease
  Element
N01204  PRNP-PI3K-NOX2 signaling pathway
N01205  Scrapie conformation PrPSc to PRNP-PI3K-NOX2 signaling pathway
Disease
H00292  Hypertrophic cardiomyopathy
H00567  Limb-girdle muscular dystrophy 1C
H00594  Distal myopathy
H00720  Long QT syndrome
H02179  Rippling muscle disease
H02181  Idiopathic hyperCKemia
H02182  Distal myopathy, Tateyama type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    859 (CAV3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    859 (CAV3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    859 (CAV3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    859 (CAV3)
  09164 Neurodegenerative disease
   05020 Prion disease
    859 (CAV3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    859 (CAV3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    859 (CAV3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    859 (CAV3)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 859
NCBI-ProteinID: NP_001225
OMIM: 601253
HGNC: 1529
Ensembl: ENSG00000182533
Pharos: P56539(Tbio)
UniProt: P56539
LinkDB
Position
3:8733802..8746758
AA seq 151 aa
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV
SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQVCSSIKVVLRKEV
NT seq 456 nt   +upstreamnt  +downstreamnt
atgatggcagaagagcacacagatctcgaggcccagatcgtcaaggatatccactgcaag
gagattgacctggtgaaccgagaccccaagaacattaacgaggacatagtcaaggtggat
tttgaagacgtgatcgcagagcctgtgggcacctacagctttgacggcgtgtggaaggtg
agctacaccaccttcactgtctccaagtactggtgctaccgtctgttgtccacgctgctg
ggcgtcccactggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc
tgggcggtggtgccatgcattaagagctacctgatcgagatccagtgcatcagccacatc
tactcactctgcatccgcaccttctgcaacccactcttcgcggccctgggccaggtctgc
agcagcatcaaggtggtgctgcggaaggaggtctaa

DBGET integrated database retrieval system