KEGG   Homo sapiens (human): 8742
Entry
8742              CDS       T01001                                 
Symbol
TNFSF12, APO3L, DR3LG, TNLG4A, TWEAK
Name
(RefSeq) TNF superfamily member 12
  KO
K05474  tumor necrosis factor ligand superfamily member 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8742 (TNFSF12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    8742 (TNFSF12)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   8742 (TNFSF12)
SSDB
Motif
Pfam: TNF C1q
Other DBs
NCBI-GeneID: 8742
NCBI-ProteinID: NP_003800
OMIM: 602695
HGNC: 11927
Ensembl: ENSG00000239697
Pharos: O43508(Tbio)
UniProt: O43508 Q4ACW9
Structure
LinkDB
Position
17:7549058..7557881
AA seq 249 aa
MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEEL
VAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQD
GAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLD
LLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFL
TYFGLFQVH
NT seq 750 nt   +upstreamnt  +downstreamnt
atggccgcccgtcggagccagaggcggagggggcgccggggggagccgggcaccgccctg
ctggtcccgctcgcgctgggcctgggcctggcgctggcctgcctcggcctcctgctggcc
gtggtcagtttggggagccgggcatcgctgtccgcccaggagcctgcccaggaggagctg
gtggcagaggaggaccaggacccgtcggaactgaatccccagacagaagaaagccaggat
cctgcgcctttcctgaaccgactagttcggcctcgcagaagtgcacctaaaggccggaaa
acacgggctcgaagagcgatcgcagcccattatgaagttcatccacgacctggacaggac
ggagcgcaggcaggtgtggacgggacagtgagtggctgggaggaagccagaatcaacagc
tccagccctctgcgctacaaccgccagatcggggagtttatagtcacccgggctgggctc
tactacctgtactgtcaggtgcactttgatgaggggaaggctgtctacctgaagctggac
ttgctggtggatggtgtgctggccctgcgctgcctggaggaattctcagccactgcggcg
agttccctcgggccccagctccgcctctgccaggtgtctgggctgttggccctgcggcca
gggtcctccctgcggatccgcaccctcccctgggcccatctcaaggctgcccccttcctc
acctacttcggactcttccaggttcactga

DBGET integrated database retrieval system