Homo sapiens (human): 8766 Help Entry 8766              CDS       T01001                                  Symbol RAB11A, YL8 Name (RefSeq) RAB11A, member RAS oncogene family   KO K07904   Ras-related protein Rab-11A Organism hsa  Homo sapiens (human) Pathway hsa04144   Endocytosis hsa04961   Endocrine and other factor-regulated calcium reabsorption hsa04962   Vasopressin-regulated water reabsorption hsa04972   Pancreatic secretion hsa05164   Influenza A Network nt06541  Cytoskeleton in neurons   Element N01850   MYO5B-mediated vesicle transport Brite KEGG Orthology (KO) [BR:hsa00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     8766 (RAB11A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     8766 (RAB11A)   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     8766 (RAB11A)    04961 Endocrine and other factor-regulated calcium reabsorption     8766 (RAB11A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     8766 (RAB11A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     8766 (RAB11A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     8766 (RAB11A)    04031 GTP-binding proteins [BR:hsa04031]     8766 (RAB11A) Membrane trafficking [BR:hsa04131]  Protein recycling   Rab GTPases and associated proteins    Rab GTPases     8766 (RAB11A) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    8766 (RAB11A)   Exosomal proteins of colorectal cancer cells    8766 (RAB11A) GTP-binding proteins [BR:hsa04031]  Small (monomeric) G-proteins   Rab Family    Rab11/25 [OT]     8766 (RAB11A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase AAA_22 PduV-EutP AAA_16 ABC_tran FeoB_N AAA_14 TniB NTPase_1 Gtr1_RagA AAA_24 DUF3289 FAD-SLDH AAA_21 MCM Motif Other DBs NCBI-GeneID:  8766 NCBI-ProteinID:  NP_004654 OMIM:  605570 HGNC:  9760 Ensembl:  ENSG00000103769 Pharos:  P62491(Tbio) UniProt:  P62491 Structure PDBPDBj LinkDB All DBs Position 15:65869491..65891989 Genome browser AA seq 216 aa AA seqDB search MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atgggcacccgcgacgacgagtacgactacctctttaaagttgtccttattggagattct ggtgttggaaagagtaatctcctgtctcgatttactcgaaatgagtttaatctggaaagc aagagcaccattggagtagagtttgcaacaagaagcatccaggttgatggaaaaacaata aaggcacagatatgggacacagcagggcaagagcgatatcgagctataacatcagcatat tatcgtggagctgtaggtgccttattggtttatgacattgctaaacatctcacatatgaa aatgtagagcgatggctgaaagaactgagagatcatgctgatagtaacattgttatcatg cttgtgggcaataagagtgatctacgtcatctcagggcagttcctacagatgaagcaaga gcttttgcagaaaagaatggtttgtcattcattgaaacttcggccctagactctacaaat gtagaagctgcttttcagacaattttaacagagatttaccgcattgtttctcagaagcaa atgtcagacagacgcgaaaatgacatgtctccaagcaacaatgtggttcctattcatgtt ccaccaaccactgaaaacaagccaaaggtgcagtgctgtcagaacatctaa

Homo sapiens (human): 9230 Help Entry 9230              CDS       T01001                                  Symbol RAB11B, H-YPT3, NDAGSCW Name (RefSeq) RAB11B, member RAS oncogene family   KO K07905   Ras-related protein Rab-11B Organism hsa  Homo sapiens (human) Pathway hsa04144   Endocytosis hsa04152   AMPK signaling pathway hsa04962   Vasopressin-regulated water reabsorption hsa05164   Influenza A Network nt06541  Cytoskeleton in neurons   Element N01850   MYO5B-mediated vesicle transport Disease H02470   Neurodevelopmental disorder with structural brain abnormalities Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     9230 (RAB11B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     9230 (RAB11B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     9230 (RAB11B)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     9230 (RAB11B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     9230 (RAB11B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     9230 (RAB11B)    04031 GTP-binding proteins [BR:hsa04031]     9230 (RAB11B) Membrane trafficking [BR:hsa04131]  Protein recycling   Rab GTPases and associated proteins    Rab GTPases     9230 (RAB11B) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    9230 (RAB11B)   Exosomal proteins of other body fluids (saliva and urine)    9230 (RAB11B)   Exosomal proteins of colorectal cancer cells    9230 (RAB11B) GTP-binding proteins [BR:hsa04031]  Small (monomeric) G-proteins   Rab Family    Rab11/25 [OT]     9230 (RAB11B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase AAA_22 PduV-EutP AAA_16 ABC_tran AAA_14 Gtr1_RagA Csa3_N FeoB_N NTPase_1 TniB AAA_24 DUF3289 FAD-SLDH AAA_21 Motif Other DBs NCBI-GeneID:  9230 NCBI-ProteinID:  NP_004209 OMIM:  604198 HGNC:  9761 Ensembl:  ENSG00000185236 Pharos:  Q15907(Tbio) UniProt:  Q15907 Structure PDBPDBj LinkDB All DBs Position 19:8390360..8404434 Genome browser AA seq 218 aa AA seqDB search MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atggggacccgggacgacgagtacgactacctattcaaagtggtgctcatcggggactca ggcgtgggcaagagcaacctgctgtcgcgcttcacccgcaacgagttcaacctggagagc aagagcaccatcggcgtggagttcgccacccgcagcatccaggtggacggcaagaccatc aaggcgcagatctgggacaccgctggccaggagcgctaccgcgccatcacctccgcgtac taccgtggtgcagtgggcgccctgctggtgtacgacatcgccaagcacctgacctatgag aacgtggagcgctggctgaaggagctgcgggaccacgcagacagcaacatcgtcatcatg ctggtgggcaacaagagtgacctgcgccacctgcgggctgtgcccactgacgaggcccgc gccttcgcagaaaagaacaacttgtccttcatcgagacctcagccttggattccactaac gtagaggaagcattcaagaacatcctcacagagatctaccgcatcgtgtcacagaaacag atcgcagaccgcgctgcccacgacgagtccccggggaacaacgtggtggacatcagcgtg ccgcccaccacggacggacagaagcccaacaagctgcagtgctgccagaacctgtga

DBGET integrated database retrieval system