KEGG   Homo sapiens (human): 88
Entry
88                CDS       T01001                                 
Symbol
ACTN2, CMD1AA, CMH23, CMYP8, MPD6, MYOCOZ
Name
(RefSeq) actinin alpha 2
  KO
K21073  actinin alpha 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04820  Cytoskeleton in muscle cells
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
Network
nt06539  Cytoskeleton in muscle cells
  Element
N01815  Vinculin-talin-integrin macromolecular complex
N01820  Sarcomere, Z-disc
Disease
H00292  Hypertrophic cardiomyopathy
H00294  Dilated cardiomyopathy
H00594  Distal myopathy
H01810  Congenital myopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    88 (ACTN2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    88 (ACTN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    88 (ACTN2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    88 (ACTN2)
   04147 Exosome [BR:hsa04147]
    88 (ACTN2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    88 (ACTN2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     88 (ACTN2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   88 (ACTN2)
  Exosomal proteins of colorectal cancer cells
   88 (ACTN2)
  Exosomal proteins of bladder cancer cells
   88 (ACTN2)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 CAMSAP_CH AIF-1 Nsp1_C EF-hand_11 XisI
Other DBs
NCBI-GeneID: 88
NCBI-ProteinID: NP_001094
OMIM: 102573
HGNC: 164
Ensembl: ENSG00000077522
UniProt: P35609
Structure
LinkDB
Position
1:236686499..236764631
AA seq 894 aa
MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIE
NIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAE
EIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSW
KDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKP
DERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT
IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAF
MPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGK
EQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVN
DRCQKICDQWDRLGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQ
DMFIVHSIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYS
TVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEI
ARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHI
RVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRA
CLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS
DKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL
NT seq 2685 nt   +upstreamnt  +downstreamnt
atgaaccagatagagcccggcgtgcagtacaactacgtgtacgacgaggatgagtacatg
atccaggaggaggagtgggaccgcgacctgctcctggacccagcctgggagaagcagcag
aggaagaccttcactgcctggtgtaactcccacctaaggaaagccggcacccagattgag
aacatcgaggaagacttcaggaatggccttaagctcatgctgcttttggaagtcatctca
ggggaaaggctgcccaaacctgaccggggaaaaatgcggttccacaaaattgctaatgtc
aacaaagctttggattacatagccagcaaaggggtgaaactggtgtccattggcgctgaa
gaaattgttgatggcaacgtgaaaatgaccctgggtatgatctggaccatcatccttcgc
tttgctattcaggatatttcggttgaagaaacatctgccaaagaaggtctgctgctttgg
tgtcagaggaaaactgctccttatagaaatgtgaacattcagaacttccatactagctgg
aaagatggccttggactctgtgccctcatccaccgacaccggcctgacctcattgactac
tcaaagcttaacaaggatgaccccataggaaatattaacctggccatggaaatcgctgag
aagcacctggatattcctaaaatgttggatgctgaagacatcgtgaacacccctaaaccc
gatgaaagagccatcatgacgtacgtctcttgcttctaccacgcttttgcgggcgcggag
caggccgagacagcggctaacaggatatgtaaggttcttgctgtgaatcaagagaatgag
aggctgatggaagaatatgagaggctagcgagtgagcttttggaatggattcgtcgcacg
atcccctggctggagaaccggactcccgagaagaccatgcaagccatgcagaagaagctg
gaggacttccgggattaccgccggaagcacaagccacccaaggtgcaggagaaatgccag
ctggagatcaacttcaacacgctgcagaccaagctgcggatcagcaaccgtcctgccttc
atgccctccgagggcaagatggtgtcggatattgctggtgcctggcagaggctggagcag
gctgagaagggttacgaggagtggttgctcaatgagattcggagactggagcgcttggaa
cacctggctgagaagttcaggcagaaggcctcaacgcacgagacttgggcttatggcaaa
gagcagatcttgctgcagaaggattacgagtcggcgtcgctgacagaggtgcgggctctg
ctgcggaagcacgaggcgttcgagagcgacctggcagcgcaccaggaccgcgtggagcag
atcgcagccatcgcgcaggagctcaatgaactggactatcacgacgctgtgaatgtcaat
gatcggtgccagaaaatttgtgaccagtgggaccgactgggaacgcttactcagaagagg
agagaagccctagagagaatggagaaattgctagaaaccattgatcagcttcacctggag
tttgccaagagggctgctcctttcaacaattggatggagggcgctatggaggatctgcaa
gatatgttcattgtccacagcattgaggagatccagagtctgatcactgcgcatgagcag
ttcaaggccacgctgcccgaggcggacggagagcggcagtccatcatggccatccagaac
gaggtggagaaggtgattcagagctacaacatcagaatcagctcaagcaacccgtacagc
actgtcaccatggatgagctccggaccaagtgggacaaggtgaagcaactcgtgcccatc
cgcgatcaatccctgcaggaggagctggctcgccagcatgctaacgagcgtctgaggcgc
cagtttgctgcccaagccaatgccattgggccctggatccagaacaagatggaggagatt
gcccggagctccatccagatcacaggagccctggaagaccagatgaaccagctgaagcag
tatgagcacaacatcatcaactataagaacaacatcgacaagctggagggagaccatcag
ctcatccaggaggcccttgtctttgacaacaagcacacgaactacacgatggagcacatt
cgtgttggatgggagctgctgctgacaaccatcgccagaaccatcaatgaggtggagact
cagatcctgacgagagatgcgaagggcatcacccaggagcagatgaatgagttcagagcc
tccttcaaccactttgacaggaggaagaatggcctgatggatcatgaggatttcagagcc
tgcctgatttccatgggttatgacctgggtgaagccgaatttgcccgcattatgaccctg
gtagatcccaacgggcaaggcaccgtcaccttccaatccttcatcgacttcatgactaga
gagacggctgacaccgacactgccgagcaggtcatcgcctccttccggatcctggcttct
gataagccatacatcctggcggaggagctgcgtcgggagctgcccccggatcaggcccag
tactgcatcaagaggatgcccgcctactcgggcccaggcagtgtgcctggtgcactggat
tacgctgcgttctcttccgcactctacggggagagcgatctgtga

KEGG   Homo sapiens (human): 89
Entry
89                CDS       T01001                                 
Symbol
ACTN3, ACTN3D
Name
(RefSeq) actinin alpha 3
  KO
K21073  actinin alpha 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04820  Cytoskeleton in muscle cells
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
Network
nt06539  Cytoskeleton in muscle cells
  Element
N01815  Vinculin-talin-integrin macromolecular complex
N01820  Sarcomere, Z-disc
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    89 (ACTN3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    89 (ACTN3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    89 (ACTN3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    89 (ACTN3)
   04147 Exosome [BR:hsa04147]
    89 (ACTN3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    89 (ACTN3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     89 (ACTN3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   89 (ACTN3)
  Exosomal proteins of colorectal cancer cells
   89 (ACTN3)
  Exosomal proteins of bladder cancer cells
   89 (ACTN3)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_7 EF-hand_1 EF-hand_6 CAMSAP_CH EF-hand_8 AIF-1 PRP9_N
Other DBs
NCBI-GeneID: 89
NCBI-ProteinID: NP_001095
OMIM: 102574
HGNC: 165
Ensembl: ENSG00000248746
UniProt: Q08043 B4DZQ2
Structure
LinkDB
Position
11:66546395..66563334
AA seq 901 aa
MMMVMQPEGLGAGEGRFAGGGGGGEYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLR
KAGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVK
LVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNV
QNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAED
IVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASEL
LEWIRRTVPWLENRVGEPSMSAMQRKLEDFRDYRRLHKPPRIQEKCQLEINFNTLQTKLR
LSHRPAFMPSEGKLVSDIANAWRGLEQVEKGYEDWLLSEIRRLQRLQHLAEKFRQKASLH
EAWTRGKEEMLSQRDYDSALLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQELNELDY
HEAASVNSRCQAICDQWDNLGTLTQKRRDALERMEKLLETIDRLQLEFARRAAPFNNWLD
GAVEDLQDVWLVHSVEETQSLLTAHDQFKATLPEADRERGAIMGIQGEIQKICQTYGLRP
CSTNPYITLSPQDINTKWDMVRKLVPSCDQTLQEELARQQVNERLRRQFAAQANAIGPWI
QAKVEEVGRLAAGLAGSLEEQMAGLRQQEQNIINYKTNIDRLEGDHQLLQESLVFDNKHT
VYSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKQNGMM
EPDDFRACLISMGYDLGEVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTTEQVVA
SFKILAGDKNYITPEELRRELPAKQAEYCIRRMVPYKGSGAPAGALDYVAFSSALYGESD
L
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgatgatggttatgcagcccgagggtctgggggccggggaggggcgctttgcgggcggc
ggcgggggcggcgagtacatggaacaggaggaggactgggaccgcgacctgctgctggac
ccggcctgggagaagcagcagcggaaaaccttcactgcctggtgcaactcacacctgcgc
aaggcaggcacccagatcgagaacatcgaggaagatttccgcaatggcctcaaactcatg
ctgctcctggaggtcatttcaggtgagaggctgcctaggccagataaaggcaagatgcgc
ttccacaaaatcgccaacgttaacaaggccctggacttcattgccagcaagggggttaaa
ctggtgtccattggtgctgaagagattgttgacgggaacctgaagatgaccctgggcatg
atctggaccatcatccttcgcttcgccatccaggacatctctgtggaagaaacctcagcc
aaggaaggcttgcttctgtggtgccagaggaagacagcaccgtaccgcaacgtcaacgtg
cagaacttccacaccagctggaaggatggcctggccctctgtgccctcatccaccgacac
cgccctgacctcatcgactacgccaaactgcgaaaggatgaccccatcggaaacctgaac
actgcctttgaggtggcagagaaatacctggacatccccaagatgttggatgcagaagac
attgtgaacaccccaaagccggatgagaaggccatcatgacctatgtgtcctgcttctac
catgcctttgccggggctgagcaggcagagacagctgccaacaggatctgcaaggtgctg
gcagtgaaccaggaaaacgagaagctgatggaggagtatgagaagcttgccagtgagctg
ctggagtggatccgccgcactgtcccatggctggagaaccgtgtgggtgagcccagcatg
agtgccatgcagcgcaaactagaggactttcgggactaccggcgtctgcacaagccgccc
cgcattcaggaaaagtgccagctggagatcaacttcaacacactgcagaccaagttgcgg
ctcagccaccggcctgccttcatgccctccgagggcaagctggtctcggacatcgccaac
gcctggcgggggctggagcaggtggaaaagggctatgaggactggctgctctcggagatc
cggcgcctgcagcgactccagcacctggctgagaagttccggcagaaggcctccctgcac
gaagcctggacccggggaaaggaggagatgctgagccagcgcgactacgattcggctttg
ctacaggaggtgcgggcgttgctgcggcgccacgaggcctttgagagcgacctggcggcg
caccaggaccgcgtggagcacattgccgcgctggcccaggagctcaatgagctggactac
cacgaggcagcctcagtgaatagccgctgccaggccatctgcgatcagtgggacaacctg
ggcaccctgacccagaagaggcgggatgcgctagagcggatggagaagctcctggagacc
attgaccggctgcaactggagtttgcccggcgggccgcgcccttcaacaactggctggat
ggtgccgtggaggacctgcaggacgtgtggctggtacactctgtggaggagacccagagc
ctgctgacagcgcacgatcagttcaaggcaacactgcccgaggctgaccgagagcgaggt
gccatcatgggcatccagggtgagatccagaagatctgccagacgtatgggctgcggccc
tgctccaccaatccctacatcaccctcagcccgcaggacatcaacaccaagtgggatatg
gtccgaaagctggtgcccagctgtgaccagacactgcaggaggagctggcacggcagcag
gtaaacgagaggctccggcgacagtttgcggcccaggccaatgccattggaccctggatc
caggcgaaggtggaggaagtggggcggctggcagcagggctagctggctctctggaggag
cagatggctgggctacggcagcaggagcagaacattatcaactacaagactaacattgac
cggctggagggtgaccaccagctgctgcaggagagcctggtgttcgacaataagcacacc
gtctacagcatggagcacatccgcgtgggctgggagcagctgctcacctccattgcccgc
accatcaatgaagtggagaaccaggtactgacccgagacgccaagggactgagccaggag
cagctcaacgagttccgagcatccttcaaccactttgacaggaagcagaatgggatgatg
gagcctgatgacttccgagcttgcctcatctccatgggctatgacctgggggaagtggag
tttgctcgcatcatgaccatggtggaccccaacgcagctggggtggtgaccttccaggcc
ttcatagacttcatgacccgagagacagccgagactgacacgactgagcaagttgtagct
tccttcaagatcttggcaggagacaagaactacatcacccccgaggagctgcggcgcgag
ctccctgccaagcaggccgagtactgcatccgccgtatggtgccctacaagggatccggg
gccccggctggagccctggactacgtggccttctccagtgccctctatggggagagcgac
ctttga

DBGET integrated database retrieval system