KEGG   Homo sapiens (human): 8883
Entry
8883              CDS       T01001                                 
Symbol
NAE1, A-116A10.1, APPBP1, HPP1, ula-1
Name
(RefSeq) NEDD8 activating enzyme E1 subunit 1
  KO
K04532  NEDD8-activating enzyme E1 regulatory subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
Drug target
Pevonedistat (DG01832): D10413 D10654
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    8883 (NAE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8883 (NAE1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   8883 (NAE1)
SSDB
Motif
Pfam: ThiF E1_4HB
Other DBs
NCBI-GeneID: 8883
NCBI-ProteinID: NP_003896
OMIM: 603385
HGNC: 621
Ensembl: ENSG00000159593
Pharos: Q13564(Tchem)
UniProt: Q13564
Structure
LinkDB
Position
16:complement(66802878..66830976)
AA seq 534 aa
MAQLGKLLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTII
DGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFF
CRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNAL
EDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEK
EDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQ
TPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNH
VAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPD
NEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVH
EFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggcgcagctgggaaagctgctcaaggagcagaagtacgaccggcagctgaggttgtgg
ggtgatcatgggcaagaggctttagaatctgctcatgtttgcctaataaatgcaacagcc
acaggaactgaaattcttaaaaacttggtactaccaggtattggttcgtttacaattatt
gatggaaatcaggtcagcggagaagatgctggaaacaatttcttccttcaaagaagcagt
atcggcaagaaccgagctgaagctgccatggaattcttacaagaattaaatagcgatgtc
tctggaagttttgtggaagagagtccagaaaaccttctagacaatgatccctcatttttc
tgtaggtttactgttgtagttgcaactcagcttcctgaaagcacttcactacgcttagca
gatgtcctctggaattcccagattcctcttttgatctgtaggacatatggactagttggt
tatatgaggatcattataaaagaacatccagtaatagaatctcatccagataatgcatta
gaggatctacgactagataagccatttcctgaactgagagaacattttcagtcctatgat
ttggatcatatggaaaaaaaggaccacagtcatactccatggattgtgatcatagctaaa
tatttagcacagtggtatagtgaaacaaatggacgaatacctaaaacgtataaagaaaaa
gaggacttcagagatttgattagacaaggaattctaaaaaatgaaaatggggctccagaa
gatgaagagaattttgaagaagctattaaaaatgtgaacacagcactaaatacaactcag
atcccaagcagtattgaagatatatttaatgatgatcgctgcataaatatcaccaaacag
actccatcattttggattttagctcgtgccttaaaggaatttgtggccaaagagggtcaa
ggaaatttacctgttcgaggcacaattcctgatatgattgcagattcaggcaaatatata
aaactgcaaaacgtttaccgtgaaaaagcaaagaaagatgctgccgctgtgggtaatcat
gttgccaaattgctgcagtccattggccaggcaccagagtccatttcagagaaagaatta
aaattactctgcagcaattctgcatttcttcgagtggtaagatgtcgatccttagctgaa
gaatatggtttggatacaattaacaaggatgaaattatttctagcatggacaatccagat
aatgaaatagtgttgtacttaatgttacgggctgttgatagatttcataaacaacagggt
agatatccaggagtatctaactatcaagttgaagaagatataggaaagttgaagtcttgt
ctcactggcttccttcaggaatatggtttatctgtaatggtgaaagatgattatgtccac
gaattttgccgatatggagctgctgagccacataccattgctgcattcttggggggagct
gctgctcaagaggtcatcaaaataatcaccaaacaatttgtaatttttaataatacttac
atttacagtggcatgtcacaaacttcagcaactttccagttgtag

DBGET integrated database retrieval system