KEGG   Homo sapiens (human): 90381
Entry
90381             CDS       T01001                                 
Symbol
TICRR, C15orf42, SLD3, Treslin
Name
(RefSeq) TOPBP1 interacting checkpoint and replication regulator
  KO
K26117  Treslin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Network
nt06509  DNA replication
  Element
N01468  DNA replication licensing
N01470  Pre-IC formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    90381 (TICRR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    90381 (TICRR)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   Other initiation factors
    90381 (TICRR)
SSDB
Motif
Pfam: Treslin_N
Other DBs
NCBI-GeneID: 90381
NCBI-ProteinID: NP_689472
OMIM: 613298
HGNC: 28704
Ensembl: ENSG00000140534
UniProt: Q7Z2Z1
LinkDB
Position
15:89575469..89628023
AA seq 1910 aa
MACCHKVMLLLDTAGGAARHSRVRRAALRLLTYLSCRFGLARVHWAFKFFDSQGARSRPS
RVSDFRELGSRSWEDFEEELEARLEDRAHLPGPAPRATHTHGALMETLLDYQWDRPEITS
PTKPILRSSGRRLLDVESEAKEAEAALGGLVNAVFLLAPCPHSQRELLQFVSGCEAQAQR
LPPTPKQVMEKLLPKRVREVMVARKITFYWVDTTEWSKLWESPDHLGYWTVCELLHHGGG
TVLPSESFSWDFAQAGEMLLRSGIKLSSEPHLSPWISMLPTDATLNRLLYNSPEYEASFP
RMEGMLFLPVEAGKEIQETWTVTLEPLAMHQRHFQKPVRIFLKGSVAQWSLPTSSTLGTD
SWMLGSPEESTATQRLLFQQLVSRLTAEELHLVADVDPGEGRPPITGVISPLSASAMILT
VCRTKEAEFQRHVLQTAVADSPRDTASLFSDVVDSILNQTHDSLADTASAASPVPEWAQQ
ELGHTTPWSPAVVEKWFPFCNISGASSDLMESFGLLQAASANKEESSKTEGELIHCLAEL
YQRKSREESTIAHQEDSKKKRGVPRTPVRQKMNTMCRSLKMLNVARLNVKAQKLHPDGSP
DVAGEKGIQKIPSGRTVDKLEDRGRTLRSSKPKDFKTEEELLSYIRENYQKTVATGEIML
YACARNMISTVKMFLKSKGTKELEVNCLNQVKSSLLKTSKSLRQNLGKKLDKEDKVRECQ
LQVFLRLEMCLQCPSINESTDDMEQVVEEVTDLLRMVCLTEDSAYLAEFLEEILRLYIDS
IPKTLGNLYNSLGFVIPQKLAGVLPTDFFSDDSMTQENKSPLLSVPFLSSARRSVSGSPE
SDELQELRTRSAKKRRKNALIRHKSIAEVSQNLRQIEIPKVSKRATKKENSHPAPQQPSQ
PVKDTVQEVTKVRRNLFNQELLSPSKRSLKRGLPRSHSVSAVDGLEDKLDNFKKNKGYHK
LLTKSVAETPVHKQISKRLLHRQIKGRSSDPGPDIGVVEESPEKGDEISLRRSPRIKQLS
FSRTHSASFYSVSQPKSRSVQRVHSFQQDKSDQRENSPVQSIRSPKSLLFGAMSEMISPS
EKGSARMKKRSRNTLDSEVPAAYQTPKKSHQKSLSFSKTTPRRISHTPQTPLYTPERLQK
SPAKMTPTKQAAFKESLKDSSSPGHDSPLDSKITPQKRHTQAGEGTSLETKTPRTPKRQG
TQPPGFLPNCTWPHSVNSSPESPSCPAPPTSSTAQPRRECLTPIRDPLRTPPRAAAFMGT
PQNQTHQQPHVLRAARAEEPAQKLKDKAIKTPKRPGNSTVTSSPPVTPKKLFTSPLCDVS
KKSPFRKSKIECPSPGELDQKEPQMSPSVAASLSCPVPSTPPELSQRATLDTVPPPPPSK
VGKRCRKTSDPRRSIVECQPDASATPGVGTADSPAAPTDSRDDQKGLSLSPQSPPERRGY
PGPGLRSDWHASSPLLITSDTEHVTLLSEAEHHGIGDLKSNVLSVEEGEGLRTADAEKSS
LSHPGIPPSPPSCGPGSPLMPSRDVHCTTDGRQCQASAQLDNLPASAWHSTDSASPQTYE
VELEMQASGLPKLRIKKIDPSSSLEAEPLSKEESSLGEESFLPALSMPRASRSLSKPEPT
YVSPPCPRLSHSTPGKSRGQTYICQACTPTHGPSSTPSPFQTDGVPWTPSPKHSGKTTPD
IIKDWPRRKRAVGCGAGSSSGRGEVGADLPGSLSLLESEGKDHGLELSIHRTPILEDFEL
EGVCQLPDQSPPRNSMPKAEEASSWGQFGLSSRKRVLLAKEEADRGAKRICDLREDSEVS
KSKEGSPSWSAWQLPSTGDEEVFVSGSTPPPSCAVRSCLSASALQALTQSPLLFQGKTPS
SQSKDPRDEDVDVLPSTVEDSPFSRAFSRRRPISRTYTRKKLMGTWLEDL
NT seq 5733 nt   +upstreamnt  +downstreamnt
atggcatgctgtcacaaagtaatgctgctgctggacaccgcgggcggcgccgcccgccac
agccgggtccggcgggccgccctgcgcctcctcacctatctgagttgccgattcggcctg
gccagggtccactgggccttcaagttctttgactcgcagggggcgcggagccggccgtcc
cgcgtgtctgacttccgcgagctggggtcccgctcgtgggaggactttgaggaggagctg
gaggccaggctcgaggatcgcgcccacctgcccggcccggcgcccagggccacccacacg
cacggcgccctgatggagacgctgctagactaccagtgggaccggcccgagatcacgtcg
cccacgaagccgatcctgcggagcagcgggaggagactgctggacgtggagagcgaggcc
aaggaggccgaggccgcgctcgggggcttggtgaacgccgtcttcctcctggccccctgt
ccgcactcgcagagggagctgctgcagttcgtgtctgggtgcgaggcccaggcccagcgc
ctgccgcccacccctaagcaggtgatggagaagttgttgcccaagagagtccgggaagtc
atggtcgcccgaaaaatcaccttctactgggtggataccaccgaatggtctaagttgtgg
gaatccccagaccaccttggatactggactgtttgtgaactgctccaccacggaggtggc
actgtcttgccatctgaatctttcagctgggattttgctcaagctggggaaatgctgctc
aggagtggaataaagctgtcaagtgaacctcatctttctccgtggatttcaatgctgcca
actgatgccactttaaaccgtttgctctacaattctcctgagtatgaggcctcgtttcca
cgaatggaaggaatgttatttctccctgttgaagcaggcaaagagattcaagaaacatgg
acagtcaccctagagcccttggccatgcatcagagacattttcagaaaccagtcagaatt
tttctaaaaggctcagtggcccagtggtctctcccaacgagcagcactttgggcactgac
agctggatgctaggaagtccagaggagagcacagcaactcaaaggctgttatttcagcag
ttggtaagcaggctgactgctgaagagttacacctggttgctgatgtggaccctggtgaa
ggccggccccccatcactggagttatttccccactctctgccagtgctatgatcctcact
gtgtgccgcaccaaggaggctgaatttcaacgacatgttctccaaacagctgtggctgac
agcccccgggacacagcttcccttttctcagatgttgtggatagtatattgaatcagact
catgattcgcttgcagatactgcttctgctgcttctcctgttccagagtgggcccagcag
gagcttggccacaccactccctggagtccagctgttgtggaaaagtggtttcctttctgt
aacatcagtggtgccagttccgatttgatggagtcatttgggttactacaggctgcctca
gctaataaggaagagtcttccaaaactgaaggcgaattaatacattgccttgccgagctc
taccagagaaaatctcgtgaagaatccactatagctcatcaagaagacagcaaaaagaaa
cgaggggtccctcgtactccagtgagacagaagatgaataccatgtgccgttccttaaag
atgttgaatgtcgcaaggctgaatgtgaaggcccagaagttacatccagatggcagtccg
gatgtggctggggagaaaggaatccaaaagatacctagtgggagaacagtggataaattg
gaagacagaggaagaacactaagaagttctaaacctaaagattttaaaactgaggaagag
ctgctatcatatatacgtgaaaattaccaaaagactgtggccacaggagaaatcatgttg
tatgcatgtgctcgaaacatgatctcaaccgttaaaatgttcctaaaatcaaaaggcacc
aaggaattagaagtgaactgcctgaatcaagtaaaaagtagtctcttaaaaactagtaaa
agtcttcgacagaatctaggaaaaaaactggataaggaagacaaagttagagagtgccag
cttcaggtatttcttcgtttggagatgtgtctgcaatgcccttcaataaatgaaagtaca
gatgatatggaacaagtagtggaggaggtgacagatttgctgcgcatggtgtgtttaact
gaggattcagcgtacctagcagagtttctggaggaaattttgagattgtatattgactct
atcccaaagacacttggaaatctttacaacagcctagggtttgtgattcctcagaagctg
gctggtgtccttcctacagattttttcagtgatgactccatgacacaagagaacaaatca
ccacttctttctgtgccttttttgtcaagtgctcgtagatcagtgtcaggcagccctgaa
tctgatgaactgcaggaacttcgtaccagatcagccaagaagagaaggaaaaatgcatta
ataagacataaaagcattgctgaggtttcacagaatcttcgacaaattgaaattcctaaa
gtgtcaaagagagctacgaaaaaagagaactctcaccctgctcctcagcagccttcccag
ccagtgaaagatacagtgcaagaagtgaccaaagttcgaagaaatcttttcaaccaggaa
ttgctttccccttcaaagagatcactaaagcgggggttgcctagaagccattctgtgtca
gctgtggatggtctagaggataaacttgacaacttcaagaagaacaaaggttatcacaaa
ctgctgactaagagtgtggccgagactccagtgcataagcagatctccaaaaggctgctg
cacagacaaatcaagggcaggtcctctgatcctggtcctgatattggtgttgttgaagag
tcccctgaaaaaggagatgaaataagtctgagacgaagtcctcgaatcaagcagttgtca
tttagcaggacacattctgcctccttctattctgtgtctcagccgaagtctcgaagtgtg
caaagagtccactctttccagcaagataagtcagaccaaagagaaaattctccagtccaa
agtattcggtctcccaagagtcttctttttggggcaatgtctgagatgatcagcccctca
gaaaagggttcagctcgaatgaaaaagcgttcaagaaacactttggattcggaggtacct
gcagcttaccagactcccaagaagagtcaccagaaatctctgagcttttctaaaactaca
ccaagaaggatctctcatacaccacaaactccgttgtatactccagaaaggctgcagaag
tcccctgcaaaaatgacccctacaaagcaggcagcttttaaggagtccttaaaagactcc
tcctcacccggccatgactcaccattggattcaaaaatcactcctcaaaaacgacatacc
caggcaggagaaggtacctctcttgaaacgaagacaccaagaactcctaagaggcaaggt
actcagccgcctgggtttttgccaaactgtacttggccacattcagtgaattccagtcca
gaaagcccctcctgtccagcccctccaacttcatcgactgcccagcccaggagagagtgt
ctcactcccatcagagaccctctcagaacacctccgagagcagcagccttcatgggcacg
cctcagaatcaaacacaccaacagccccatgtcctcagagctgctcgggcagaggaacca
gcccagaaactaaaggataaagctatcaaaactccaaaaagaccagggaattcaactgtg
acttcttccccacctgttacgccaaagaaactgtttacctctcctttatgtgatgtctcc
aagaagagtccatttaggaaatctaaaatagagtgtccttccccaggagaactggatcag
aaagagccccagatgtcacccagcgtagctgcatctctctcctgccctgttccctcaact
ccccctgaactctcacagagagctacattggacaccgtccctcctccacccccttctaaa
gttgggaaacggtgtagaaagacctctgatcccagaaggagcatcgtggagtgtcagcct
gatgcctccgctactcctggggttggcacagctgacagcccagctgcccccacagactct
agagatgaccagaagggactgagcctctctcctcagtctcctcctgaaagacggggctac
ccaggccctggtctcaggagtgattggcatgcatcctctcctctgctcattacaagtgac
acagagcatgtcactctcctcagtgaagccgaacaccatggcattggtgacttgaaaagt
aacgtcttatcagtggaagagggtgaggggctaaggacagcagatgctgagaagtcttct
ctgtctcaccctgggattcccccatctcctccttcctgtgggcctggctctcctctgatg
ccttcccgtgacgtgcactgtaccacagatgggagacagtgccaggcttcggcacaacta
gacaacctgccagcatcagcttggcattccacagactctgccagcccacagacctatgag
gttgagctggagatgcaagcttctggccttcccaaacttcgaattaagaagatagacccc
agctcttcattagaggctgagcccctcagcaaggaggagagctctctgggagaagagagc
ttcctccctgctctcagcatgcccagggccagcaggtccttaagcaaacctgaacccacc
tatgtgtcacccccctgcccccgcctctcccacagcacacctggcaagagcagggggcaa
acctacatctgccaggcctgtacccccacccacggcccttctagtaccccctctccattt
caaacagatggggttccttggacaccatcccccaagcacagtgggaagacaactccagac
ataattaaagactggcccaggaggaagagggcggtgggctgtggcgccggctcctcttcc
gggaggggcgaggtcggtgcagaccttcctgggagcctgtcactgcttgagtcagagggc
aaggaccacggccttgaactcagcatccacaggacgcccatcttggaggattttgagctc
gagggagtgtgccagctcccagaccagtcgcctcccaggaacagcatgcctaaggccgag
gaagcctcttcctggggacagtttgggttgagttccaggaagagagtcctgttggccaag
gaagaagctgaccgtggagccaaaaggatctgtgacctgagagaagattcagaagttagt
aagagtaaagaggggtctccaagttggagtgcatggcagctaccctccacgggagacgaa
gaggtgtttgtttccggctccaccccacctcccagctgtgccgtgcggagctgcctctct
gccagtgccctccaggctctgacccagtctccgctgctgttccaggggaaaacaccttcc
tctcagagcaaagaccccagagatgaggatgtggatgttcttccctccactgtagaagac
tctcctttcagtcgcgctttctccaggaggcgccccatcagcagaacttatacacggaag
aagctcatgggaacctggctggaggacttatag

DBGET integrated database retrieval system