Homo sapiens (human): 9073 Help Entry 9073              CDS       T01001                                  Symbol CLDN8, HEL-S-79 Name (RefSeq) claudin 8   KO K06087   claudin Organism hsa  Homo sapiens (human) Pathway hsa03272   Virion - Hepatitis viruses hsa04514   Cell adhesion molecules hsa04530   Tight junction hsa04670   Leukocyte transendothelial migration hsa05130   Pathogenic Escherichia coli infection hsa05160   Hepatitis C Network nt06180  Pathogenic Escherichia coli   Element N01287   Tight junction-Actin signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     9073 (CLDN8)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     9073 (CLDN8)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     9073 (CLDN8)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     9073 (CLDN8)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     9073 (CLDN8)   09171 Infectious disease: bacterial    05130 Pathogenic Escherichia coli infection     9073 (CLDN8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hsa03037]     9073 (CLDN8)    04147 Exosome [BR:hsa04147]     9073 (CLDN8) Cilium and associated proteins [BR:hsa03037]  Other cilia and associated proteins   Stereociliary proteins    9073 (CLDN8) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    9073 (CLDN8)   Exosomal proteins of colorectal cancer cells    9073 (CLDN8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Motif Other DBs NCBI-GeneID:  9073 NCBI-ProteinID:  NP_955360 OMIM:  611231 HGNC:  2050 Ensembl:  ENSG00000156284 UniProt:  P56748 A0A0K0K1I9 LinkDB All DBs Position 21:complement(30214006..30216097) Genome browser AA seq 225 aa AA seqDB search MATHALEIAGLFLGGVGMVGTVAVTVMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANI RMQCKIYDSLLALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILL TAGIIFIITGMVVLIPVSWVANAIIRDFYNSIVNVAQKRELGEALYLGWTTALVLIVGGA LFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV NT seq 678 nt NT seq  +upstreamnt  +downstreamnt atggcaacccatgccttagaaatcgctgggctgtttcttggtggtgttggaatggtgggc acagtggctgtcactgtcatgcctcagtggagagtgtcggccttcattgaaaacaacatc gtggtttttgaaaacttctgggaaggactgtggatgaattgcgtgaggcaggctaacatc aggatgcagtgcaaaatctatgattccctgctggctctttctccggacctacaggcagcc agaggactgatgtgtgctgcttccgtgatgtccttcttggctttcatgatggccatcctt ggcatgaaatgcaccaggtgcacgggggacaatgagaaggtgaaggctcacattctgctg acggctggaatcatcttcatcatcacgggcatggtggtgctcatccctgtgagctgggtt gccaatgccatcatcagagatttctataactcaatagtgaatgttgcccaaaaacgtgag cttggagaagctctctacttaggatggaccacggcactggtgctgattgttggaggagct ctgttctgctgcgttttttgttgcaacgaaaagagcagtagctacagatactcgatacct tcccatcgcacaacccaaaaaagttatcacaccggaaagaagtcaccgagcgtctactcc agaagtcagtatgtgtag

DBGET integrated database retrieval system