Homo sapiens (human): 9073 Help Entry 9073              CDS       T01001                                  Symbol CLDN8, HEL-S-79 Name (RefSeq) claudin 8   KO K06087   claudin Organism hsa  Homo sapiens (human) Pathway hsa03272   Virion - Hepatitis viruses hsa04382   Cornified envelope formation hsa04514   Cell adhesion molecules hsa04530   Tight junction hsa04670   Leukocyte transendothelial migration hsa05130   Pathogenic Escherichia coli infection hsa05160   Hepatitis C Network nt06180  Pathogenic Escherichia coli   Element N01287   Tight junction-Actin signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     9073 (CLDN8)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     9073 (CLDN8)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     9073 (CLDN8)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     9073 (CLDN8)   09158 Development and regeneration    04382 Cornified envelope formation     9073 (CLDN8)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     9073 (CLDN8)   09171 Infectious disease: bacterial    05130 Pathogenic Escherichia coli infection     9073 (CLDN8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hsa03037]     9073 (CLDN8)    04147 Exosome [BR:hsa04147]     9073 (CLDN8)    04515 Cell adhesion molecules [BR:hsa04515]     9073 (CLDN8) Cilium and associated proteins [BR:hsa03037]  Other cilia and associated proteins   Stereociliary proteins    9073 (CLDN8) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    9073 (CLDN8)   Exosomal proteins of colorectal cancer cells    9073 (CLDN8) Cell adhesion molecules [BR:hsa04515]  Immunoglobulin superfamily   L1 family    9073 (CLDN8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Motif Other DBs NCBI-GeneID:  9073 NCBI-ProteinID:  NP_955360 OMIM:  611231 HGNC:  2050 Ensembl:  ENSG00000156284 UniProt:  P56748 A0A0K0K1I9 LinkDB All DBs Position 21:complement(30214006..30216097) Genome browser AA seq 225 aa AA seqDB search MATHALEIAGLFLGGVGMVGTVAVTVMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANI RMQCKIYDSLLALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILL TAGIIFIITGMVVLIPVSWVANAIIRDFYNSIVNVAQKRELGEALYLGWTTALVLIVGGA LFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV NT seq 678 nt NT seq  +upstreamnt  +downstreamnt atggcaacccatgccttagaaatcgctgggctgtttcttggtggtgttggaatggtgggc acagtggctgtcactgtcatgcctcagtggagagtgtcggccttcattgaaaacaacatc gtggtttttgaaaacttctgggaaggactgtggatgaattgcgtgaggcaggctaacatc aggatgcagtgcaaaatctatgattccctgctggctctttctccggacctacaggcagcc agaggactgatgtgtgctgcttccgtgatgtccttcttggctttcatgatggccatcctt ggcatgaaatgcaccaggtgcacgggggacaatgagaaggtgaaggctcacattctgctg acggctggaatcatcttcatcatcacgggcatggtggtgctcatccctgtgagctgggtt gccaatgccatcatcagagatttctataactcaatagtgaatgttgcccaaaaacgtgag cttggagaagctctctacttaggatggaccacggcactggtgctgattgttggaggagct ctgttctgctgcgttttttgttgcaacgaaaagagcagtagctacagatactcgatacct tcccatcgcacaacccaaaaaagttatcacaccggaaagaagtcaccgagcgtctactcc agaagtcagtatgtgtag

DBGET integrated database retrieval system