Homo sapiens (human): 9074 Help Entry 9074              CDS       T01001                                  Symbol CLDN6 Name (RefSeq) claudin 6   KO K06087   claudin Organism hsa  Homo sapiens (human) Pathway hsa03272   Virion - Hepatitis viruses hsa04382   Cornified envelope formation hsa04514   Cell adhesion molecules hsa04530   Tight junction hsa04670   Leukocyte transendothelial migration hsa05130   Pathogenic Escherichia coli infection hsa05160   Hepatitis C Network nt06180  Pathogenic Escherichia coli   Element N01287   Tight junction-Actin signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     9074 (CLDN6)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     9074 (CLDN6)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     9074 (CLDN6)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     9074 (CLDN6)   09158 Development and regeneration    04382 Cornified envelope formation     9074 (CLDN6)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     9074 (CLDN6)   09171 Infectious disease: bacterial    05130 Pathogenic Escherichia coli infection     9074 (CLDN6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hsa03037]     9074 (CLDN6)    04147 Exosome [BR:hsa04147]     9074 (CLDN6)    04515 Cell adhesion molecules [BR:hsa04515]     9074 (CLDN6) Cilium and associated proteins [BR:hsa03037]  Other cilia and associated proteins   Stereociliary proteins    9074 (CLDN6) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    9074 (CLDN6)   Exosomal proteins of colorectal cancer cells    9074 (CLDN6) Cell adhesion molecules [BR:hsa04515]  Immunoglobulin superfamily   L1 family    9074 (CLDN6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 GPDPase_memb Motif Other DBs NCBI-GeneID:  9074 NCBI-ProteinID:  NP_067018 OMIM:  615798 HGNC:  2048 Ensembl:  ENSG00000184697 UniProt:  P56747 LinkDB All DBs Position 16:complement(3014712..3018183) Genome browser AA seq 220 aa AA seqDB search MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG QMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLT SGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGL LCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV NT seq 663 nt NT seq  +upstreamnt  +downstreamnt atggcctctgccggaatgcagatcctgggagtcgtcctgacactgctgggctgggtgaat ggcctggtctcctgtgccctgcccatgtggaaggtgaccgctttcatcggcaacagcatc gtggtggcccaggtggtgtgggagggcctgtggatgtcctgcgtggtgcagagcaccggc cagatgcagtgcaaggtgtacgactcactgctggcgctgccacaggacctgcaggctgca cgtgccctctgtgtcatcgccctccttgtggccctgttcggcttgctggtctaccttgct ggggccaagtgtaccacctgtgtggaggagaaggattccaaggcccgcctggtgctcacc tctgggattgtctttgtcatctcaggggtcctgacgctaatccccgtgtgctggacggcg catgccatcatccgggacttctataaccccctggtggctgaggcccaaaagcgggagctg ggggcctccctctacttgggctgggcggcctcaggccttttgttgctgggtggggggttg ctgtgctgcacttgcccctcgggggggtcccagggccccagccattacatggcccgctac tcaacatctgcccctgccatctctcgggggccctctgagtaccctaccaagaattacgtc tga

DBGET integrated database retrieval system