Homo sapiens (human): 9080 Help Entry 9080              CDS       T01001                                  Symbol CLDN9, DFNB116 Name (RefSeq) claudin-9   KO K06087   claudin Organism hsa  Homo sapiens (human) Pathway hsa03272   Virion - Hepatitis viruses hsa04382   Cornified envelope formation hsa04514   Cell adhesion molecule (CAM) interaction hsa04530   Tight junction hsa04670   Leukocyte transendothelial migration hsa05130   Pathogenic Escherichia coli infection hsa05160   Hepatitis C Network nt06180  Pathogenic Escherichia coli   Element N01287   Tight junction-Actin signaling pathway Disease H00605   Deafness, autosomal recessive Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     9080 (CLDN9)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     9080 (CLDN9)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     9080 (CLDN9)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     9080 (CLDN9)   09158 Development and regeneration    04382 Cornified envelope formation     9080 (CLDN9)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     9080 (CLDN9)   09171 Infectious disease: bacterial    05130 Pathogenic Escherichia coli infection     9080 (CLDN9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hsa03037]     9080 (CLDN9)    04147 Exosome [BR:hsa04147]     9080 (CLDN9) Cilium and associated proteins [BR:hsa03037]  Other cilia and associated proteins   Stereociliary proteins    9080 (CLDN9) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    9080 (CLDN9)   Exosomal proteins of colorectal cancer cells    9080 (CLDN9) SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 TMEM_230_134 CdpA_N Motif Other DBs NCBI-GeneID:  9080 NCBI-ProteinID:  NP_066192 OMIM:  615799 HGNC:  2051 Ensembl:  ENSP00000398017.2 UniProt:  O95484 Structure PDBPDBj LinkDB All DBs Position 16:3012923..3014505 Genome browser AA seq 217 aa AA seqDB search MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG QMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLT AGVILLLAGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGL LCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atggcttcgaccggcttagaactgctgggcatgaccctggctgtgctgggctggctgggg accctggtgtcctgcgccctgcccctgtggaaggtgaccgccttcatcggcaacagcatc gtggtggcccaggtggtgtgggagggcctgtggatgtcctgcgtggtgcagagcacgggc cagatgcagtgcaaggtgtacgactcactgctggctctgccgcaggacctgcaggccgca cgtgccctctgtgtcattgccctcctgctggccctgcttggcctcctggtggccatcaca ggtgcccagtgtaccacgtgtgtggaggacgaaggtgccaaggcccgtatcgtgctcacc gcgggggtcatcctcctcctcgccggcatcctggtgctcatccctgtgtgctggacggcg cacgccatcatccaggacttctacaaccccctggtggctgaggccctcaagcgggagctg ggggcctccctctacctgggctgggcggcggctgcactgcttatgctgggcggggggctc ctctgctgcacgtgccccccgccccaggtcgagcggccccgcggacctcggctgggctac tccatcccctcccgctcgggtgcatctggactggacaagagggactacgtgtga

DBGET integrated database retrieval system