KEGG   Homo sapiens (human): 9128
Entry
9128              CDS       T01001                                 
Symbol
PRPF4, HPRP4, HPRP4P, PRP4, Prp4p, RP70, SNRNP60
Name
(RefSeq) pre-mRNA processing factor 4
  KO
K12662  U4/U6 small nuclear ribonucleoprotein PRP4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9128 (PRPF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    9128 (PRPF4)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    9128 (PRPF4)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 PRP4 NBCH_WD40 WD40_like
Other DBs
NCBI-GeneID: 9128
NCBI-ProteinID: NP_004688
OMIM: 607795
HGNC: 17349
Ensembl: ENSG00000136875
Pharos: O43172(Tchem)
UniProt: O43172
Structure
LinkDB
Position
9:113275658..113292905
AA seq 522 aa
MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGI
EAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT
LFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQTWYHEGPNSLKVARLW
IANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFS
PNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCA
ADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILH
QEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGY
HIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHP
GWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggcttcctcgcgagcctcttccacgcaggcaaccaaaactaaagcacccgacgactta
gttgctccggtcgtgaagaaaccacacatctattatggaagtttggaagagaaggagagg
gagcgtctggccaaaggagagtctgggattttggggaaagacggacttaaagcagggatc
gaagctggaaatattaatataacctctggagaagtgtttgaaattgaagagcatatcagc
gagcgacaggcagaagtattggctgagtttgagagaaggaagcgagcccggcagatcaat
gtttccacagatgactcagaggtcaaagcttgccttagagccttgggggaacccatcaca
ctttttggagagggtcctgctgaaagaagagaaaggttaagaaatatcctctcagttgtc
ggtactgatgccttgaaaaagaccaaaaaggatgatgagaagtctaaaaagtccaaagaa
gagtatcagcaaacctggtatcatgaaggaccaaatagcttgaaggtggcaagactatgg
attgctaattattcgttgcccagggcaatgaaacgcttggaagaggcccgactccataag
gagattcctgagacaacaaggacctcccagatgcaagagctgcacaagtctctccggtct
ttgaataatttttgcagtcagattggggatgatcggcctatctcctactgtcactttagt
cccaattccaagatgctggccacagcttgttggagtgggctttgcaagctctggtctgtt
cctgattgcaacctccttcacactcttcgagggcataacacaaatgtaggagcaattgta
ttccatcccaaatccactgtctccttggacccaaaagatgtcaacctggcctcttgtgcg
gctgatggctctgtgaagctttggagtctcgacagtgatgaaccagtggcagatattgaa
ggccatacagtgcgtgtggcgcgggtaatgtggcatccttcaggacgtttcctgggcacc
acctgctatgaccgttcatggcgcttatgggatttggaggctcaagaggagatcctgcat
caggaaggccatagcatgggtgtgtatgacattgccttccatcaagatggctctttggct
ggcactgggggactggatgcatttggtcgagtttgggacctacgcacaggacgttgtatc
atgttcttagaaggccacctgaaagaaatctatggaataaatttctcccccaatggctat
cacattgcaaccggcagtggtgacaacacctgcaaagtgtgggacctccgacagcggcgt
tgcgtctacaccatccctgctcatcagaacttagtgactggtgtcaagtttgagcctatc
catgggaacttcttgcttactggtgcctatgataacacagccaagatctggacgcaccca
ggctggtccccgctgaagactctggctggccacgaaggcaaagtgatgggcctagatatt
tcttccgatgggcagctcatagccacttgctcatatgacaggaccttcaagctgtggatg
gctgaatag

DBGET integrated database retrieval system