KEGG   Homo sapiens (human): 9181
Entry
9181              CDS       T01001                                 

Gene name
ARHGEF2, GEF, GEF-H1, GEFH1, LFP40, Lfc, NEDMHM, P40
Definition
(RefSeq) Rho/Rac guanine nucleotide exchange factor 2
  KO
K12791  Rho guanine nucleotide exchange factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01285  Microtubule-RHOA signaling pathway
Disease
H02470  Neurodevelopmental disorder with structural brain abnormalities
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    9181 (ARHGEF2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9181 (ARHGEF2)
   05131 Shigellosis
    9181 (ARHGEF2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    9181 (ARHGEF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9181 (ARHGEF2)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    9181 (ARHGEF2)
SSDB
Motif
Pfam: PH_16 RhoGEF C1_1 PH C1_2 Prok-RING_1 zinc_ribbon_9 PHD
Other DBs
NCBI-GeneID: 9181
NCBI-ProteinID: NP_001155855
OMIM: 607560
HGNC: 682
Ensembl: ENSG00000116584
Vega: OTTHUMG00000017464
Pharos: Q92974(Tbio)
UniProt: Q92974
LinkDB
Structure
PDB: 
5EFX

Position
1q22
AA seq 986 aa
MSRIESLTRARIDRSRELASKTREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSI
TAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRERP
SSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM
RNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVI
YELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLLER
RRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLYKELYARDK
RFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALG
LVKELLSNVDEGIYQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLL
WKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFL
ISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKMELQQK
DRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRGERLLQDAIR
EVEGLKDLLVGPGVELLLTPREPALPLEPDSGGNTSPGVTANGEARTFNGSIELCRADSD
SSQRDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPERREKLCRA
NSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARLR
ESEQARALLEREAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNPP
QPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHS
PRDFTRMQDIPEETESRDGEAVASES
NT seq 2961 nt   +upstreamnt  +downstreamnt
atgtctcggatcgaatccctcacgcgggcgcggatcgaccggagcagagagctggcgagc
aagacccgggaaaaggagaagatgaaggaagccaaggatgcccgctataccaatgggcac
ctcttcaccaccatttcagtttcaggcatgaccatgtgctatgcctgtaacaagagcatc
acagccaaggaagccctcatctgcccaacctgcaatgtgactatccacaaccgctgtaaa
gacaccctcgccaactgtaccaaggtcaagcagaagcaacagaaagcggccctgctgaag
aacaacaccgccttgcagtccgtttctcttcgaagtaagacaaccatccgggagcggcca
agctcggccatctacccctccgacagcttccggcagtccctcctgggctcccgccgtggc
cgctcctccttgtctttagccaagagtgtttctaccaccaacattgctggacatttcaat
gatgagtctcccctggggctgcgccggatcctctcacagtccacagactccctcaacatg
cggaaccgaaccctatccgtggaatccctcattgacgaagcagaggtaatctacagtgag
ctgatgagtgactttgagatggatgagaaggactttgcagctgactcttggagtcttgct
gtggacagcagcttcctgcagcagcataaaaaggaggtgatgaagcagcaagatgtcatc
tatgagctaatccagacagagctgcaccatgtgaggacactgaagatcatgacccgcctc
ttccgcacggggatgctggaagagctacacttggagccaggagtggtccagggcctgttc
ccctgcgtggacgagctcagtgacatccatacacgcttcctcagccagctattagaacgc
cgacgccaggccctgtgccctggcagcacccggaactttgtcatccatcgcttgggtgat
ctgctcatcagccagttctcaggtcctagtgcggagcagatgtgtaagacctactcggag
ttctgcagccgccacagcaaggccttaaagctctataaggagctgtacgcccgagacaaa
cgcttccagcaattcatccggaaagtgacccgccccgccgtgctcaagcggcacggggta
caggagtgcatcctgctggtgactcagcgcatcaccaagtacccgttactcatcagccgc
atcctgcagcattcccacgggatcgaggaggagcgccaggacctgaccacagcactgggg
ctagtgaaggagctgctgtccaatgtggacgagggtatttatcagctggagaaaggggcc
cgtctgcaggagatctacaaccgcatggaccctcgggcccaaaccccagtgcctggcaag
ggcccctttggccgagaggaacttctgaggcgcaaactcatccacgatggctgcctgctc
tggaagacagcgacggggcgcttcaaagatgtgctagtgctgctgatgacagatgtactg
gtgtttctccaggaaaaggaccagaagtacatctttcctaccctggacaagccttcagtg
gtatcgctgcagaatctaatcgtacgagacattgccaaccaggagaaagggatgtttctg
atcagcgcagccccacctgagatgtacgaggtgcacacagcatcccgggatgaccggagc
acctggatccgggtcattcagcagagcgtgcgcacatgcccatccagggaggacttcccc
ctgattgagacagaggatgaggcttacctgcggcgaattaagatggagttgcagcagaag
gaccgggcactggtggagctgctgcgagagaaggtcgggctgtttgctgagatgacccat
ttccaggccgaagaggatggtggcagtgggatggccctgcccaccctgcccaggggcctt
ttccgctctgagtcccttgagtcccctcgtggcgagcggctgctgcaggatgccatccgt
gaggtggagggtctgaaagacctgctggtggggccaggagtggaactgctcttgacaccc
cgagagccagccctgcccttggaaccagacagcggtggtaacacgagtcctggggtcact
gccaatggtgaggccagaaccttcaatggctccattgaactctgcagagctgactcagac
tctagccagagggatcgaaatggaaatcagctgagatcaccgcaagaggaggcgttacag
cgattggtcaatctctatggacttctacatggcctacaggcagctgtggcccagcaggac
actctgatggaagcccggttccctgagggccctgagcggcgggagaagctgtgccgagcc
aactctcgggatggggaggctggcagggctggggctgcccctgtggcccctgaaaagcag
gccacggaactggcattactgcagcggcaacatgcgctgctgcaggaggagctacggcgc
tgccggcggctaggtgaagaacgggcaaccgaagctggcagcctggaggcccggctccgg
gagagtgagcaggcccgggcactgctggagcgtgaggccgaagaggctcgaaggcagctg
gccgccctgggccagaccgagccactcccagctgaggccccctgggcccgcagacctgtg
gatcctcggcggcgcagcctccccgcaggcgatgccctgtacttgagtttcaacccccca
cagcccagccgaggcactgaccgcctggatctacctgtcactactcgctctgtccatcga
aactttgaggaccgagagaggcaggaactggggagccccgaagagcggctgcaagacagc
agtgaccctgacactggcagcgaggaggaaggtagcagccgtctgtctccgccccacagt
ccacgagactttaccagaatgcaggacatcccggaggagacggagagccgcgacggggag
gctgtagcctccgagagctaa

DBGET integrated database retrieval system