KEGG   Homo sapiens (human): 9319
Entry
9319              CDS       T01001                                 
Symbol
TRIP13, 16E1BP, MVA3, OOMD9, OZEMA9
Name
(RefSeq) thyroid hormone receptor interactor 13
  KO
K22399  pachytene checkpoint protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Network
nt06515  Regulation of kinetochore-microtubule interactions
  Element
N01533  Disassembly of MCC
Disease
H01288  Mosaic variegated aneuploidy syndrome
H01897  Oocyte/zygote/embryo maturation arrest
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    9319 (TRIP13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9319 (TRIP13)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Others
     9319 (TRIP13)
SSDB
Motif
Pfam: AAA AAA_22 nSTAND3 AAA_16 AAA_18 AAA_14 Viral_helicase1 AAA_28 AAA_33 KAP_NTPase AAA_5 AAA_25 AAA_24 Cytidylate_kin TsaE RuvB_N RNA_helicase ATPase_2 DUF815 AAA_11 AAA_7 ABC_tran NACHT AAA_30 IstB_IS21 AAA_17 TIP49 bpMoxR ATPase Mg_chelatase AAA_19 PduV-EutP PhoH NRBF2 SLFN-g3_helicase Rad17 Zot nSTAND1 SPC25 AAA_3
Other DBs
NCBI-GeneID: 9319
NCBI-ProteinID: NP_004228
OMIM: 604507
HGNC: 12307
Ensembl: ENSG00000071539
UniProt: Q15645
Structure
LinkDB
Position
5:892884..919348
AA seq 432 aa
MDEAVGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHNIVFGDYTWTE
FDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENII
AANHWVLPAAEFHGLWDSLVYDVEVKSHLLDYVMTTLLFSDKNVNSNLITWNRVVLLHGP
PGTGKTSLCKALAQKLTIRLSSRYRYGQLIEINSHSLFSKWFSESGKLVTKMFQKIQDLI
DDKDALVFVLIDEVESLTAARNACRAGTEPSDAIRVVNAVLTQIDQIKRHSNVVILTTSN
ITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQLLTLRELEMIG
FIENNVSKLSLLLNDISRKSEGLSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDK
QFEERKKLAAYI
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggacgaggccgtgggcgacctgaagcaggcgcttccctgtgtggccgagtcgccaacg
gtccacgtggaggtgcatcagcgcggcagcagcactgcaaagaaagaagacataaacctg
agtgttagaaagctactcaacagacataatattgtgtttggtgattacacatggactgag
tttgatgaaccttttttgaccagaaatgtgcagtctgtgtctattattgacacagaatta
aaggttaaagactcacagcccatcgatttgagtgcatgcactgttgcacttcacattttc
cagctgaatgaagatggccccagcagtgaaaatctggaggaagagacagaaaacataatt
gcagcaaatcactgggttctacctgcagctgaattccatgggctttgggacagcttggta
tacgatgtggaagtcaaatcccatctcctcgattatgtgatgacaactttactgttttca
gacaagaacgtcaacagcaacctcatcacctggaaccgggtggtgctgctccacggtcct
cctggcactggaaaaacatccctgtgtaaagcgttagcccagaaattgacaattagactt
tcaagcaggtaccgatatggccaattaattgaaataaacagccacagcctcttttctaag
tggttttcggaaagtggcaagctggtaaccaagatgtttcagaagattcaggatttgatt
gatgataaagacgccctggtgttcgtgctgattgatgaggtggagagtctcacagccgcc
cgaaatgcctgcagggcgggcaccgagccatcagatgccatccgcgtggtcaatgctgtc
ttgacccaaattgatcagattaaaaggcattccaatgttgtgattctgaccacttctaac
atcaccgagaagatcgacgtggccttcgtggacagggctgacatcaagcagtacattggg
ccaccctctgcagcagccatcttcaaaatctacctctcttgtttggaagaactgatgaag
tgtcagatcatataccctcgccagcagctgctgaccctccgagagctagagatgattggc
ttcattgaaaacaacgtgtcaaaattgagccttcttttgaatgacatttcaaggaagagc
gagggcctcagcggccgggtcctgagaaaactcccctttctggctcatgcgctgtatgtc
caggcccccaccgtcaccatagaggggttcctccaggccctgtctctggcagtggacaag
cagtttgaagagagaaagaagcttgcagcttacatctga

DBGET integrated database retrieval system