KEGG   Homo sapiens (human): 9618
Entry
9618              CDS       T01001                                 
Symbol
TRAF4, CART1, MLN62, RNF83
Name
(RefSeq) TNF receptor associated factor 4
  KO
K09848  TNF receptor-associated factor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04657  IL-17 signaling pathway
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    9618 (TRAF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9618 (TRAF4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    9618 (TRAF4)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-Nse zf-RING_2 zf-RING_6 zf-C3HC4_4 zf-TRAF_2 MATH zf-rbx1
Other DBs
NCBI-GeneID: 9618
NCBI-ProteinID: NP_004286
OMIM: 602464
HGNC: 12034
Ensembl: ENSG00000076604
Vega: OTTHUMG00000132677
Pharos: Q9BUZ4(Tbio)
UniProt: Q9BUZ4 A0A024QZ59
Structure
LinkDB
Position
17:28744011..28750956
AA seq 470 aa
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLL
AQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLK
DSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQELRRELE
ELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcctggcttcgactacaagttcctggagaagcccaagcgacggctgctgtgcccactg
tgcgggaagcccatgcgcgagcctgtgcaggtttccacctgcggccaccgtttctgcgat
acctgcctgcaggagttcctcagtgaaggagtcttcaagtgccctgaggaccagcttcct
ctggactatgccaagatctacccagacccggagctggaagtacaagtattgggcctgcct
atccgctgcatccacagtgaggagggctgccgctggagtgggccactacgtcatctacag
ggccacctgaatacctgcagcttcaatgtcattccctgccctaatcgctgccccatgaag
ctgagccgccgtgatctacctgcacacttgcagcatgactgccccaagcggcgcctcaag
tgcgagttttgtggctgtgacttcagtggggaggcctatgagagccatgagggtatgtgc
ccccaggagagtgtctactgtgagaataagtgtggtgcccgcatgatgcggcggctgctg
gcccagcatgccacctctgagtgccccaagcgcactcagccctgcacctactgcactaag
gagttcgtctttgacaccatccagagccaccagtaccagtgcccaaggctgcctgttgcc
tgccccaaccaatgtggtgtgggcactgtggctcgggaggacctgccaggccatctgaag
gacagctgtaacaccgccctggtgctctgcccattcaaagactccggctgcaagcacagg
tgccctaagctggcaatggcacggcatgtggaggagagtgtgaagccacatctggccatg
atgtgtgccctggtgagccggcaacggcaggagctgcaggagcttcggcgagagctggag
gagctatcagtgggcagtgatggcgtgctcatctggaagattggcagctatggacggcgg
ctacaggaggccaaggccaagcccaaccttgagtgcttcagcccagccttctacacacat
aagtatggttacaagctgcaggtgtctgcattcctcaatggcaatggcagtggtgagggc
acacacctctcactgtacattcgtgtgctgcctggtgcctttgacaatctccttgagtgg
ccctttgcccgccgtgtcaccttctccctgctggatcagagcgaccctgggctggctaaa
ccacagcacgtcactgagaccttccaccccgacccaaactggaagaatttccagaagcca
ggcacgtggcggggctccctggatgagagttctctgggctttggttatcccaagttcatc
tcccaccaggacattcgaaagcgaaactatgtgcgggatgatgcagtcttcatccgtgct
gctgttgaactgccccggaagatcctcagctga

DBGET integrated database retrieval system