KEGG   Homo sapiens (human): 9631
Entry
9631              CDS       T01001                                 
Symbol
NUP155, ATFB15, N155
Name
(RefSeq) nucleoporin 155
  KO
K14312  nuclear pore complex protein Nup155
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Disease
H00731  Atrial fibrillation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    9631 (NUP155)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    9631 (NUP155)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    9631 (NUP155)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     9631 (NUP155)
SSDB
Motif
Pfam: Nucleoporin_N Nucleoporin_C Paramyxo_P CagY_I
Other DBs
NCBI-GeneID: 9631
NCBI-ProteinID: NP_705618
OMIM: 606694
HGNC: 8063
Ensembl: ENSG00000113569
Vega: OTTHUMG00000090803
Pharos: O75694(Tbio)
UniProt: O75694 A0A024R071
Structure
LinkDB
Position
5:complement(37288137..37371106)
AA seq 1391 aa
MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGM
SDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTID
SDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSY
ANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAY
QAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVI
QVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLA
VTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLM
AASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDH
IPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFK
LHQEDQACATCLILACSTAACDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGS
PVYSSSPVPSGSPYPNPSFLGTPSHGIQPPAMSTPVCALGNPATQATNMSCVTGPEIVYS
GKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEF
LDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQA
IQQLVRKSYQALALWKLLCEHQFTIIVAELQKELQEQLKITTFKDLVIRDKELTGALIAS
LINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRES
LKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIV
GLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHF
EQMLKLSQRSKDELFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDL
LWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEF
LHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAE
CKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPR
FFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKP
LHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNF
KSLQAKLERLH
NT seq 4176 nt   +upstreamnt  +downstreamnt
atgccgtcttctttgttgggcgcggcgatgccggcctctacatctgccgcagccctgcag
gaagctctggaaaatgctggacggctcatcgaccgtcagttgcaagaggaccgcatgtac
ccggacctttccgagctgcttatggtgtctgccccaaataatcccaccgtttctggcatg
tcagatatggattatcctttgcaaggacctggtttgctgtccgtacccaaccttccagag
atcagttccatccgaagagttcctctcccacctgaacttgttgagcagtttggacatatg
cagtgtaattgcatgatgggtgtgttccctcctatcagcagagcttggctcacaattgac
agtgatatattcatgtggaactatgaggatggaggagaccttgcctattttgatggactt
agtgagactattcttgctgtggggcttgtgaagccaaaagcaggcatctttcaacctcat
gtgcgacacctcctggttttggcgacccctgtagacatagtaattcttggactcagctat
gctaatttgcaaacaggttctggagttcttaatgatagtttgtctggtggaatgcagttg
cttccagatcctttatattctcttcctactgataatacttaccttttaacaataacttcc
actgataatggcagaattttcttggctggaaaggatggctgtttatatgaagtagcctac
caggctgaagcagggtggtttagccaaagatgtaggaaaataaaccactcaaagagctca
ctttctttccttgttccttccttgctacaattcacgttctcagaagatgatcctattctt
caaattgcaattgataattctagaaatattttatatacacgatctgagaaaggagtaata
caggtgtatgatttgggacaagatggacaaggaatgagcagagttgcctctgtgtcacag
aatgccattgtctctgctgctggtaacattgctaggaccatcgatcgttctgtttttaaa
ccaattgtccaaatagcagtgattgaaaattctgaatcactggactgtcagttattggct
gtcacacatgcaggtgttaggttatattttagcacttgtccattcagacagccattagca
cggcctaatacactgacgctggttcatgtccgcttacctcctggattctcagcatcttca
accgtggaaaagccttcaaaagtacatagagctctttatagtaaaggtattctattgatg
gcagcctcagaaaatgaggataatgatattttatggtgtgtcaaccatgatacttttcct
ttccaaaagccaatgatggaaacccagatgacagctggtgttgatggtcattcctgggct
ctttctgcgatagatgaattgaaagtagataaaataattacacctttaaacaaggatcat
attccaataactgattcaccagttgttgtacagcagcacatgttacctccgaagaaattt
gttctcctctcagcacaggggagccttatgtttcataaacttagacctgtagatcaactg
aggcatctacttgtgagtaatgtgggaggagatggagaagagattgaaagattctttaaa
ttacatcaggaagaccaggcttgtgcaacttgccttattcttgcttgctccactgctgcc
tgtgatagagaagtatctgcctgggctactcgggctttctttaggtatggtggtgaagca
cagatgagatttccaaccactcttccgcctccaagtaatgttggtcccatcttggggtct
cctgtctattctagttctcctgttcctagtggtagtccctatccaaatccatcctttttg
ggaacaccgtctcatggtatacagcctcctgccatgtcaactccagtgtgtgctctggga
aacccagcaactcaggccacaaatatgagttgtgtgactggaccagagattgtgtactct
ggaaaacacaatggtatttgcatttacttttctcggatcatgggaaacatttgggatgca
agcttagttgtggagagaatattcaagagtggcaacagagagatcactgcaattgaaagt
agtgttccctgccaactgctagagtcagtgctacaagaactaaagggtttgcaggaattt
ctagacagaaactcccagtttgcaggaggaccattaggaaatccaaatactactgctaaa
gtgcagcagaggctgataggattcatgcgtcctgaaaacggaaatccccagcaaatgcaa
caggaactgcagaggaagtttcatgaggctcaactaagtgaaaagatttcacttcaggca
attcagcagttggttcgaaaatcatatcaggctctggctttatggaaacttctttgtgaa
catcaattcactatcattgtggcagaacttcagaaggaacttcaagagcagctgaagatc
accacctttaaagatcttgtaatcagggacaaagaactcacaggggcattaattgcttct
cttatcaactgctacatcagagataatgccgctgttgatggcattagtttacatttacag
gatatctgcccacttctatatagcactgatgatgcaatttgttctaaggcaaatgagctt
ctccagcgttcccgacaagttcaaaataagactgaaaaagaaagaatgttaagggaatca
ttaaaggaatatcaaaaaattagcaatcaagtggacctttccaatgtttgtgctcagtat
agacaagtgagattttatgagggtgtggtggaactttctcttacggctgcagagaaaaaa
gatcctcaaggtcttgggcttcatttctataaacatggagaaccagaagaagacatagtt
ggacttcaggccttccaagaaagattaaacagttacaaatgcattacagacacacttcaa
gaactggtaaatcaaagtaaggccgctcctcagtctcccagtgtacccaaaaaacctggt
cctccagtgttgtcatctgatccaaatatgctgagtaatgaagaagcaggacatcatttt
gaacaaatgcttaaattgtcacagcgatccaaggatgagctctttagtattgccctttat
aattggctaatacaagtcgaccttgcagataagctgctacaggttgcttctccatttctg
gagccacatctagtccgaatggccaaagttgatcaaaacagagttcgttatatggattta
ctctggcggtattacgagaagaacagaagtttcagtaatgctgctcgtgtactgtccaga
ctggctgacatgcatagcacagaaatttcacttcagcagcgactagagtacattgctcga
gccattcttagtgccaaaagttccactgccatttcatcaatagctgccgatggtgaattt
cttcatgaattagaagaaaaaatggaggttgctaggatccaacttcagatacaggagaca
ctacaaaggcagtattcccatcattcttctgtacaggatgcagtttctcagctggattct
gagctgatggacataactaagctttatggggaatttgctgacccatttaaacttgcagag
tgcaaacttgcaataattcattgtgccggttattcagaccctatattggtgcagacactt
tggcaagatatcatagagaaagaattgagtgacagtgtgacattgagctcctcggataga
atgcatgctcttagtctcaagattgttctccttggcaaaatttatgctggcacaccacgc
ttctttcctttagattttattgtacagtttttagaacagcaggtttgtactttgaactgg
gatgtgggcttcgtaatacagacaatgaatgaaattggagtaccattacctagactacta
gaagtttatgatcagttgttcaaatcacgggatccattctggaacagaatgaagaagcca
ctgcaccttttggattgtatacatgtattattgataagatatgttgagaatcccagccaa
gttttaaattgtgaaaggagaagatttacaaatctctgcctggatgctgtttgtggttac
cttgttgagctccagtctatgagctcgtcagtagcagtacaagccatcactgggaatttt
aaatctcttcaagctaaattagaacggcttcattaa

DBGET integrated database retrieval system