KEGG   Homo sapiens (human): 9690
Entry
9690              CDS       T01001                                 
Symbol
UBE3C, HECTH2, RAUL
Name
(RefSeq) ubiquitin protein ligase E3C
  KO
K10589  ubiquitin-protein ligase E3 C [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9690 (UBE3C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9690 (UBE3C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     9690 (UBE3C)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   9690 (UBE3C)
SSDB
Motif
Pfam: HECT IQ
Other DBs
NCBI-GeneID: 9690
NCBI-ProteinID: NP_055486
OMIM: 614454
HGNC: 16803
Ensembl: ENSG00000009335
Pharos: Q15386(Tbio)
UniProt: Q15386
Structure
LinkDB
Position
7:157138926..157269370
AA seq 1083 aa
MFSFEGDFKTRPKVSLGGASRKEEKASLLHRTQEERRKREEERRRLKNAIIIQSFIRGYR
DRKQQYSIQRSAFDRCATLSQSGGAFPIANGPNLTLLVRQLLFFYKQNEDSKRLIWLYQN
LIKHSSLFVKQLDGSERLTCLFQIKRLMSLCCRLLQNCNDDSLNVALPMRMLEVFSSENT
YLPVLQDASYVVSVIEQILHYMIHNGYYRSLYLLINSKLPSSIEYSDLSRVPIAKILLEN
VLKPLHFTYNSCPEGARQQVFTAFTEEFLAAPFTDQIFHFIIPALADAQTVFPYEPFLNA
LLLIESRCSRKSGGAPWLFYFVLTVGENYLGALSEEGLLVYLRVLQTFLSQLPVSPASAS
CHDSASDSEEESEEADKPSSPEDGRLSVSYITEECLKKLDTKQQTNTLLNLVWRDSASEE
VFTTMASVCHTLMVQHRMMVPKVRLLYSLAFNARFLRHLWFLISSMSTRMITGSMVPLLQ
VISRGSPMSFEDSSRIIPLFYLFSSLFSHSLISIHDNEFFGDPIEVVGQRQSSMMPFTLE
ELIMLSRCLRDACLGIIKLAYPETKPEVREEYITAFQSIGVTTSSEMQQCIQMEQKRWIQ
LFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIG
PLQSTLDVGLESPPLSVSEERQLAVLTELPFVVPFEERVKIFQRLIYADKQEVQGDGPFL
DGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNEL
LKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFA
GFFLSKLLGTSADVDIHHLASLDPEVYKNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVV
ELKFGGKDIPVTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEI
QVLISGAQVPISLEDLKSFTNYSGGYSADHPVIKVFWRVVEGFTDEEKRKLLKFVTSCSR
PPLLGFKELYPAFCIHNGGSDLERLPTASTCMNLLKLPEFYDETLLRSKLLYAIECAAGF
ELS
NT seq 3252 nt   +upstreamnt  +downstreamnt
atgttcagcttcgaaggcgacttcaagacgcggcccaaggtgtcccttggcggcgcgagc
aggaaggaggaaaaggcttctcttttacatcgtactcaggaagaaagaagaaagagagag
gaagaaaggcgaaggttgaaaaatgcaataattatccagtcatttattcgaggctataga
gacagaaaacagcaatattccatccaaagaagtgcatttgatcgctgtgctaccttgtca
cagtccgggggcgcttttcccattgctaatggccccaaccttacccttttggtaaggcag
cttctgtttttttacaaacaaaatgaagactcaaaacgtttgatatggctgtatcagaac
ttaattaaacacagctctctgtttgtcaagcagttggatggatctgagagacttacatgc
ttatttcagataaaaagattgatgagcctctgttgcaggttgctgcaaaactgtaatgat
gacagtttgaatgttgcacttccaatgagaatgcttgaagtattttcgtctgagaatact
tacttgcctgttttacaagatgctagctatgtggtgtcagtgattgaacaaattttgcac
tacatgattcacaatgggtattataggtctctatatttgttgattaacagcaagcttcca
tcaagtattgaatattctgatttatctcgagttcctatagcaaaaattttgctagagaat
gttctaaaaccattgcactttacttacaactcctgtccggaaggtgcgaggcaacaagtt
tttacagccttcacagaggagtttctggcagcaccttttacagatcagatttttcatttc
atcattccggcgcttgcagatgcgcagaccgttttcccttacgagccctttctgaatgca
ctgttgttaatagagagtagatgttcaagaaagagtggtggagcaccctggcttttctat
ttcgttttaactgttggcgaaaattatttgggggccctctctgaggaagggctgctggtg
tatttgcgggtgctgcagaccttcctctctcagttaccagtctctcctgccagcgcgagc
tgtcacgactcagccagtgactctgaggaggagagtgaagaagccgacaagccctcaagc
ccggaggatggcagactgtcagtatcatacataacagaggaatgcctgaagaagctggac
acaaagcagcagaccaacaccctgctcaacctggtgtggagggactctgcgagcgaggag
gtcttcaccaccatggcctccgtctgccacacgctgatggtgcagcaccgcatgatggta
cccaaagtcaggcttctctacagtttagcctttaatgccaggtttctgagacatctttgg
tttctaatatcttccatgtcaacacggatgatcacagggtctatggtaccgttgcttcag
gtgatatccaggggttctcctatgtcttttgaagattctagtcgaatcatcccactcttt
tatctttttagctccttgtttagtcattcactaatttccatacatgataacgaattcttc
ggtgatcccatagaagttgtaggtcaaagacaatcatcaatgatgccttttactttagaa
gagctgataatgttgtctcgatgccttcgagatgcatgcctggggatcatcaagttggct
tatccagaaaccaagccagaagttcgagaagaatatattacagcatttcagagtattgga
gttactactagctctgaaatgcaacaatgcatacagatggaacagaaaagatggattcag
ttatttaaggttatcaccaatctagtgaaaatgttgaagtccagagacacgaggagaaat
ttttgtcctccaaaccactggctgtcagaacaagaagatattaaagcagataaggtcact
cagctctatgtgccagcatccagacatgtgtggaggttccggcggatggggaggataggc
ccgctgcagtccaccctggacgtgggtttggagtccccgccgctgtctgtgtctgaggaa
agacagcttgctgtcctgacagagttgccttttgtggttccatttgaggaacgagtaaag
atctttcagaggttgatttatgcagataagcaagaagttcaaggagatggtccatttctg
gatggaattaatgtcacaataagaagaaattacatttatgaagatgcttatgacaaactt
tctccagaaaatgagcctgatttgaaaaagcggatccgtgtgcacttgctcaatgcccat
ggcctggatgaagctggcattgatggtggtggtattttcagagagtttttaaatgaacta
ctgaagtcaggatttaaccccaaccaggggttctttaagactactaatgaagggcttctg
taccccaacccggctgctcagatgcttgtgggagattcttttgccagacattactacttc
ctaggcagaatgcttggaaaggctctctatgagaacatgctggtggagctgccctttgca
ggcttctttctttccaagttgcttggaaccagtgccgacgtggacattcaccacctcgcc
tccctagaccctgaggtgtataagaatttgctctttctgaagagctacgaagacgatgtg
gaggagcttgggctgaacttcactgtggtgaacaatgacctgggagaggcgcaggtagtt
gaactaaaattcggtgggaaagacatccctgtcaccagcgccaaccggattgcgtacatc
cacttggtggcagactacaggctgaacaggcagatccgccagcactgcctggctttccgc
cagggccttgccaatgtcgtcagcctcgagtggctccgaatgtttgatcagcaagaaatt
caggtattaatttctggtgcacaagttcccataagcctagaggacctaaaatcctttaca
aactattcaggaggctattctgcagaccatcctgttattaaggtcttctggagagttgtg
gaagggttcactgatgaagaaaagcgcaaactgctgaagtttgtaacaagctgctctcga
ccccctctcttggggtttaaggagttgtatcccgcattttgtattcacaacggaggctcc
gaccttgagcggctccccacagccagcacctgcatgaacctgctgaagctccccgagttc
tatgacgagacacttttgcgaagtaaacttctctatgcgattgaatgtgccgctggcttt
gagctgagctga

DBGET integrated database retrieval system