KEGG   Homo sapiens (human): 9818
Entry
9818              CDS       T01001                                 
Symbol
NUP58, NUP45, NUPL1, PRO2463
Name
(RefSeq) nucleoporin 58
  KO
K14307  nucleoporin p58/p45
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    9818 (NUP58)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    9818 (NUP58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    9818 (NUP58)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     9818 (NUP58)
SSDB
Motif
Pfam: Nucleoporin_FG2 PSY3 NAM-associated
Other DBs
NCBI-GeneID: 9818
NCBI-ProteinID: NP_054808
OMIM: 607615
HGNC: 20261
Ensembl: ENSG00000139496
Vega: OTTHUMG00000016608
Pharos: Q9BVL2(Tdark)
UniProt: Q9BVL2
Structure
LinkDB
Position
13:25301625..25349800
AA seq 599 aa
MSTGFSFGSGTLGSTTVAAGGTSTGGVFSFGTGASSNPSVGLNFGNLGSTSTPATTSAPS
SGFGTGLFGSKPATGFTLGGTNTGIATTITTGLTLGTPATTSAATTGFSLGFNKPAASAT
PFALPITSTSASGLTLSSALTSTPAASTGFTLNNLGGTTATTTTASTGLSLGGALAGLGG
SLFQSTNTGTSGLGQNALGLTLGTTAATSTAGNEGLGGIDFSSSSDKKSDKTGTRPEDSK
ALKDENLPPVICQDVENLQKFVKEQKQVQEEISRMSSKAMLKVQEDIKALKQLLSLAANG
IQRNTLNIDKLKIETAQELKNAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQY
RQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGY
RKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGP
QPSLGVSFGTPFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGS
LSAGFGSSSTSGFNFSNPGITASAGLTFGVSNPASAGFGTGGQLLQLKKPPAGNKRGKR
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgtccacagggttctccttcgggtccgggactctgggctccaccaccgtggccgccggc
gggaccagcacaggcggcgttttctccttcggaacgggagcgtctagcaacccttctgtg
gggctcaattttggaaatcttggaagtacttcaactccagcaactacatctgctccttca
agtggttttggaaccgggctctttggatctaaacctgccactgggttcactctaggagga
acaaatacaggaatagcaacaactataactacaggattaactctgggaacgccagccact
acatctgcagctacaacaggcttcagtttaggattcaataaacctgcagcatctgccaca
ccatttgctctacctattacctctacctcagctagcggtctgactctttcgtctgctctg
acatcaactccagcagcatccacaggatttactctaaataatttgggtgggacaacagcc
acaactacaactgcatcaacaggcctctctttagggggagccttagctggtttgggaggt
tcacttttccagagtacaaacacaggaacatcaggacttggacagaatgctttagggttg
actttgggaactacagcagctacttcaactgcaggcaatgaaggccttggtggtatagat
ttcagtagctcctcagataaaaagagtgataaaacgggaacaagaccagaggatagtaaa
gctctgaaggatgaaaatctacctcctgtcatctgccaggatgttgaaaatctccagaaa
tttgtgaaggagcagaaacaagttcaagaagaaattagtagaatgtcttcaaaagcaatg
cttaaggtacaagaagatattaaagctctgaagcagctcctgtcgttggctgccaatgga
atacagagaaacactctcaacattgacaaattgaaaatagaaactgctcaggagttgaag
aatgctgaaatagctttaagaacccagaagacaccacctggacttcaacatgaatatgca
gctcctgctgactacttcagaatcttggttcagcaatttgaggtacagcttcagcagtac
aggcagcagattgaagaactagaaaaccatcttgccactcaagcaaataattcacatata
acccctcaagatttgtcaatggctatgcagaaaatttatcaaacatttgtagctttagcg
gcacaacttcagtctattcatgaaaatgtaaaggttctgaaagaacagtaccttggctac
aggaaaatgttcttgggagatgctgttgatgtgtttgaaacaaggcgagcagaagccaag
aagtggcagaacacacccagagttactactggacccactcctttcagcaccatgccaaac
gcagcagccgttgccatggctgcaacacttacacagcagcaacagcctgctacagggcca
cagccatctctgggagttagttttggaacgccattcggctcaggtattggcactggcttg
caatcaagtggcttaggttcttcaaaccttggaggatttggaactagctctggttttgga
tgcagcaccacaggggcctccacatttggatttggaacaacaaataaaccctcaggaagt
cttagtgcaggctttggcagctcaagtacatctgggtttaacttcagcaatcctggcatc
acggcatcagctggtttgacttttggggtgtccaatcctgcctctgcaggttttggaaca
ggaggacaactccttcagttgaagaaacctccagctggaaacaaaagaggaaaaagataa

DBGET integrated database retrieval system