KEGG   Homo sapiens (human): 9883
Entry
9883              CDS       T01001                                 
Symbol
POM121, P145, POM121A
Name
(RefSeq) POM121 transmembrane nucleoporin
  KO
K14316  nuclear pore complex protein Nup121
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    9883 (POM121)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    9883 (POM121)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    9883 (POM121)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     9883 (POM121)
SSDB
Motif
Pfam: POM121 DUF6366
Other DBs
NCBI-GeneID: 9883
NCBI-ProteinID: NP_001244119
OMIM: 615753
HGNC: 19702
Ensembl: ENSG00000196313
Vega: OTTHUMG00000023527
Pharos: Q96HA1(Tbio)
UniProt: Q96HA1
Structure
LinkDB
Position
7:72879357..72951459
AA seq 999 aa
MVCSPVTVRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKEKKRTV
EEEDQIFLDGQENKRRRHDSSGSGHSAFEPLVANGVPASFVPKPGSLKRGLNSQSSDDHL
NKRSRSSSMSSLTGAYASGIPSSSRNAITSSYSSTRGISQLWKRNGPSSSPFSSPASSRS
QTPERPAKKIREEELCHHSSSSTPLAADRESQGEKAADTTPRKKQNSNSQSTPGSSGQRK
RKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKASLQWFNQALEDKSDAASNSVTET
PPITQPSFTFTLPAAAPASPPTSLLAPSTNPLLESLKKMQTPPSLPPCPESAGAATTEAL
SPPKTPSLLPPLGLSQSGPPGLLPSPSFDSKPPTTLLGLIPAPSMVPATDTKAPPTLQAE
TATKPQATSAPSPAPKQSFLFGTQNTSPSSPAAPAASSAPPMFKPIFTAPPKSEKEGPTP
PGPSVTATAPSSSSLPTTTSTTAPTFQPVFSSMGPPASVPLPAPFFKQTTTPATAPTTTA
PLFTGLASATSAVAPITSASPSTDSASKPAFGFGINSVSSSSVSTTTSTATAASQPFLFG
APQASAASFTPAMGSIFQFGKPPALPTTTTVTTFSQSLHTAVPTATSSSAADFSGFGSTL
ATSAPATSSQPTLTFSNTSTPTFNIPFGSSAKSPLPSYPGANPQPAFGAAEGQPPGAAKP
ALAPSFGSSFTFGNSAAPAAAPTPAPPSMIKVVPAYVPTPIHPIFGGATHSAFGLKATAS
AFGAPASSQPAFGGSTAVFFGAATSSGFGATTQTASSGSSSSVFGSTTPSPFTFGGSAAP
AGSGSFGINVATPGSSTTTGAFSFGAGQSGSTATSTPFAGGLGQNALGTTGQSTPFAFNV
SSTTESKPVFGGTATPTFGLNTPAPGVGTSGSSLSFGASSAPAQGFVGVAPFGNTFAHQQ
EHSPRKGPNNLSKRKLLPAVRAQGLPRRGQASSFPTRKE
NT seq 3000 nt   +upstreamnt  +downstreamnt
atggtgtgtagcccagtgactgtgaggatcgcccctcctgacagaagattttcgcgttct
gcgataccagagcagataatcagctcaacactgtcctcaccatcaagtaacgccccagac
ccatgtgcaaaggagacagtactgagtgccctcaaagagaaggagaagaaaaggacagtg
gaggaagaagaccaaatattccttgatggccaggaaaataaaagaaggcgccatgatagc
agtggcagtggacattcagcatttgagcccctggtggccaatggagtccccgcttctttt
gtgcctaagcctgggtctctgaagagaggcctcaattctcagagctcagatgaccacttg
aataagagatcccgaagctcttccatgagctccttgacaggcgcttacgcaagtggcatc
cctagctccagccgcaatgccattaccagttcctacagctccactcgaggcatctcacag
ctctggaagagaaatggccccagttcatcacccttctctagcccagcctcctcccgctcc
cagacaccggagaggccagcaaagaaaataagagaagaggagctgtgtcatcattccagt
tcttcaactccattggcagcagacagggagtcccagggagaaaaggctgcagatacaacc
ccaaggaagaaacaaaactcgaattctcagtctacacctggcagctctgggcagcgtaag
cggaaagttcagctgctgccttctcggcgaggggaacagctgaccttgcctccacctccc
cagcttggctattcgatcactgccgaggacctagacttagagaagaaggcttcattacag
tggttcaaccaggccttggaggacaagagcgatgctgcctcgaactctgtcactgagacc
ccacctatcactcagccttcatttacctttaccctgcctgctgctgcacctgcctcccca
cccacctccctcctggccccaagcaccaacccactgttagagagcttgaagaagatgcag
actcccccgagcctgccaccctgcccagaatctgctggagcagcaaccactgaggccctc
tcacctccaaagacacccagcctcctacccccgctgggtttatcacagtcagggccgcca
gggctgctccccagcccctcctttgactccaaacccccgaccactttgctggggctgatc
cctgctccatccatggtaccagccactgacaccaaggcacctccaacccttcaggcagag
acggctaccaaaccccaagccacatctgccccgtcccccgcccccaagcaaagcttcctg
tttggaacacagaacacctcaccttccagccctgccgcccctgctgcatcttcagcacct
cccatgttcaagcccattttcacggctccacccaagagtgagaaggaaggccccacaccg
cctggcccttcagtcacagccacagcgccctccagctcctccctccccacgaccaccagc
accacagccccgaccttccagcctgtctttagcagcatggggccacctgcatctgtgccc
ttgcctgctcccttcttcaagcagacaactactcccgccactgctcccaccacaactgcc
ccgctcttcactggcctggccagcgccacctctgctgtggctcccatcacctctgccagt
ccatccacagactctgcttcgaagcctgcgtttggctttggcataaacagtgtgagcagc
agcagtgtgagtaccacgaccagcaccgccactgccgcctcacagcctttcctcttcggg
gcgccccaggcctctgctgccagcttcaccccggccatgggctccatattccagtttggc
aaacctcctgccttgcccacaaccaccacagtcaccaccttcagccagtccctgcacact
gccgtgccaacggccaccagcagcagcgctgccgactttagtggttttggcagcaccctc
gccacctccgccccggccaccagcagccagcccactctgacgttcagtaacacgagcacc
cccacgttcaacattccctttggctcaagcgccaagtccccgctcccatcatatccggga
gccaacccccagcccgcatttggggccgctgaggggcagccaccgggggccgccaagccg
gcccttgcccccagctttggcagctctttcacttttggaaactctgcagccccggctgct
gcacccacacctgcacctccgtccatgatcaaggtcgtgcctgcgtacgtgcctacgccc
atccatcctatctttggcggtgccacgcactcggcgtttgggttgaaagccacggcttcg
gccttcggcgctcccgccagctcacagcccgcctttggcggctccactgctgtcttcttc
ggtgcagccaccagctccggctttggagccaccacccagaccgccagcagcgggagcagc
agctcggtgtttggcagcacaacaccatcacccttcacgtttgggggttcggcagccccc
gctggcagtgggagctttgggatcaatgtggccaccccaggctccagcaccaccaccgga
gctttcagctttggagcaggacagagtgggagcacagccacctccacccccttcgcaggg
ggcttaggtcagaacgccctgggcaccaccggccagagcacaccgtttgccttcaacgtg
agcagcacaactgagagcaaacctgtgtttggaggcaccgccacccccacctttggtctg
aacacccctgcgcctggagtgggcacatcaggcagcagcctctcctttggggcatcctca
gcacccgcccaaggctttgttggtgttgcacctttcggcaacacttttgctcaccagcaa
gaacacagcccgaggaagggacccaataacctttcaaaacgcaaactgctgcctgcggtg
agggcccagggtcttccacggagaggacaggcatcttcctttcccaccaggaaggagtga

DBGET integrated database retrieval system