KEGG   Homo sapiens (human): 9986
Entry
9986              CDS       T01001                                 
Symbol
RCE1, FACE2, RCE1A, RCE1B
Name
(RefSeq) Ras converting CAAX endopeptidase 1
  KO
K08658  prenyl protein peptidase [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    9986 (RCE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    9986 (RCE1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-
     9986 (RCE1)
Peptidases and inhibitors [BR:hsa01002]
 Glutamic peptidases
  Family G5: prenyl protease 2 family
   9986 (RCE1)
SSDB
Motif
Pfam: Rce1-like
Other DBs
NCBI-GeneID: 9986
NCBI-ProteinID: NP_005124
OMIM: 605385
HGNC: 13721
Ensembl: ENSG00000173653
Vega: OTTHUMG00000167098
Pharos: Q9Y256(Tchem)
UniProt: Q9Y256 Q0P5W4
LinkDB
Position
11:66843441..66846552
AA seq 329 aa
MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSEL
PRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPL
LLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFR
ACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVF
GAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQ
PLTDPKLYGSLPLCVLLERAGDSEAPLCS
NT seq 990 nt   +upstreamnt  +downstreamnt
atggcggcgctgggcggggatgggctgcgactgctgtcggtgtcgcggccggagcggccg
cccgagtcggcggcgctgggcggcctgggccccgggctgtgctgctgggtgtcagtgttc
tcctgcctcagcctcgcctgctcctacgtgggcagcctctacgtctggaagagcgaactg
cccagggaccatcccgcggtcatcaagcgacgcttcaccagcgtcctggtggtgtccagt
ctctcacccctgtgcgtgctgctctggagggaactcacaggcatccagccaggcacatcc
ctgctcaccctgatgggcttcaggctggagggcattttcccagcggcgctgctgcccctg
ttgctgaccatgattcttttcctgggcccactgatgcagctctctatggattgcccttgt
gacctggcagatgggctgaaggttgtcctggccccccgctcctgggcccgctgcctcaca
gacatgcgttggctgcggaaccaagtgatcgccccgctgacagaggagctggtgttccgg
gcctgtatgctgcccatgttagcaccgtgcatgggcctgggccctgctgtgttcacctgc
ccgctcttttttggagttgcccattttcaccatattattgagcagctgcgtttccgccag
agcagcgtggggaacatcttcttgtctgctgcgttccagttctcctacacagctgtcttc
ggtgcctacactgctttcctcttcatccgcacaggacacctgattgggccggttctctgc
cattccttctgcaattacatgggtttcccagctgtttgcgcggccttggagcacccacag
aggcggcccctgctggcaggctatgccctgggtgtgggactcttcctgcttctgctccag
cccctcacggaccccaagctctacggcagccttcccctttgtgtgcttttggagcgggca
ggggactcagaggctcccctgtgctcctga

DBGET integrated database retrieval system