Mus caroli (Ryukyu mouse): 110285843 Help Entry 110285843         CDS       T05910                                  Symbol Tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal00510   N-Glycan biosynthesis mcal00513   Various types of N-glycan biosynthesis mcal04141   Protein processing in endoplasmic reticulum Module mcal_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:mcal00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     110285843 (Tmem258)    00513 Various types of N-glycan biosynthesis     110285843 (Tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110285843 (Tmem258) SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  110285843 NCBI-ProteinID:  XP_021007951 Ensembl:  MGP_CAROLIEiJ_G0022683 UniProt:  A0A6P5P0A7 LinkDB All DBs Position 19:7428947..7432516 Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaagccatgagtaggtataccagcccagtgaacccggctgtcttccctcac ctgactgtggtacttctggccatcggcatgttcttcactgcctggttcttcgtttacgag gtcacctctaccaagtacacacgagatatttacaaagagctcctcatctccttggtggcc tcactcttcatgggctttggagtcctcttcctcctgctctgggttggcatctacgtatga

DBGET integrated database retrieval system