Mus caroli (Ryukyu mouse): 110293791 Help Entry 110293791         CDS       T05910                                  Symbol Ifnb1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04060   Cytokine-cytokine receptor interaction mcal04151   PI3K-Akt signaling pathway mcal04217   Necroptosis mcal04380   Osteoclast differentiation mcal04620   Toll-like receptor signaling pathway mcal04621   NOD-like receptor signaling pathway mcal04622   RIG-I-like receptor signaling pathway mcal04623   Cytosolic DNA-sensing pathway mcal04630   JAK-STAT signaling pathway mcal04650   Natural killer cell mediated cytotoxicity mcal04668   TNF signaling pathway mcal04936   Alcoholic liver disease mcal05135   Yersinia infection mcal05142   Chagas disease mcal05152   Tuberculosis mcal05160   Hepatitis C mcal05161   Hepatitis B mcal05162   Measles mcal05163   Human cytomegalovirus infection mcal05164   Influenza A mcal05165   Human papillomavirus infection mcal05167   Kaposi sarcoma-associated herpesvirus infection mcal05168   Herpes simplex virus 1 infection mcal05169   Epstein-Barr virus infection mcal05170   Human immunodeficiency virus 1 infection mcal05171   Coronavirus disease - COVID-19 mcal05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110293791 (Ifnb1)    04668 TNF signaling pathway     110293791 (Ifnb1)    04151 PI3K-Akt signaling pathway     110293791 (Ifnb1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110293791 (Ifnb1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     110293791 (Ifnb1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110293791 (Ifnb1)    04621 NOD-like receptor signaling pathway     110293791 (Ifnb1)    04622 RIG-I-like receptor signaling pathway     110293791 (Ifnb1)    04623 Cytosolic DNA-sensing pathway     110293791 (Ifnb1)    04650 Natural killer cell mediated cytotoxicity     110293791 (Ifnb1)   09158 Development and regeneration    04380 Osteoclast differentiation     110293791 (Ifnb1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110293791 (Ifnb1)    05161 Hepatitis B     110293791 (Ifnb1)    05160 Hepatitis C     110293791 (Ifnb1)    05171 Coronavirus disease - COVID-19     110293791 (Ifnb1)    05164 Influenza A     110293791 (Ifnb1)    05162 Measles     110293791 (Ifnb1)    05168 Herpes simplex virus 1 infection     110293791 (Ifnb1)    05163 Human cytomegalovirus infection     110293791 (Ifnb1)    05167 Kaposi sarcoma-associated herpesvirus infection     110293791 (Ifnb1)    05169 Epstein-Barr virus infection     110293791 (Ifnb1)    05165 Human papillomavirus infection     110293791 (Ifnb1)   09171 Infectious disease: bacterial    05135 Yersinia infection     110293791 (Ifnb1)    05152 Tuberculosis     110293791 (Ifnb1)   09174 Infectious disease: parasitic    05142 Chagas disease     110293791 (Ifnb1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110293791 (Ifnb1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110293791 (Ifnb1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcal04052]     110293791 (Ifnb1) Cytokines and neuropeptides [BR:mcal04052]  Cytokines   Interferons    110293791 (Ifnb1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon YWFCY Spore_III_AB YebO Tat SYCE1 Motif Other DBs NCBI-GeneID:  110293791 NCBI-ProteinID:  XP_021017316 Ensembl:  MGP_CAROLIEiJ_G0026141 UniProt:  A0A6P5PTS9 LinkDB All DBs Position 4:complement(81295316..81296084) Genome browser AA seq 182 aa AA seqDB search MNNRWILHAAFLLCFSTTALSINYEQLQLQQRTNLRKCQKLLEQLNGKINLTYRTDFKIP MEMTEKMQKSHSAFAIQEMLQNVFLVFRNNFSSTGWNETLVERLLDELHQQTVFLKKILE EKQEERLTWETSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFFIIRRLTRNF QK NT seq 549 nt NT seq  +upstreamnt  +downstreamnt atgaacaacaggtggatcctccacgctgcgttcctgctgtgcttctccaccacagccctc tccatcaactacgagcagctccagctccaacaaaggacgaaccttcggaaatgtcagaag ctcctggagcagctgaatggaaagatcaacctcacctacaggacggacttcaagatccct atggagatgacggagaagatgcagaagagtcactctgcctttgccatccaagagatgctc cagaatgtctttcttgtcttcagaaacaatttctccagcactgggtggaatgagactctt gttgaacgtctcctggatgaactccaccagcagacagtgtttctgaagaaaatactagag gaaaagcaagaagaaagattgacgtgggagacgtcctcaactgctctccacttgaagagc tattactggagggtgcaaaggtaccttaaactcatgaagtacaacagctacgcctggatg gtggtccgagcagagatcttcaggaactttttcatcatccgaagacttaccagaaacttc caaaaatga

DBGET integrated database retrieval system