Mus caroli (Ryukyu mouse): 110295330 Help Entry 110295330         CDS       T05910                                  Symbol Il6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal01521   EGFR tyrosine kinase inhibitor resistance mcal01523   Antifolate resistance mcal04060   Cytokine-cytokine receptor interaction mcal04061   Viral protein interaction with cytokine and cytokine receptor mcal04066   HIF-1 signaling pathway mcal04068   FoxO signaling pathway mcal04151   PI3K-Akt signaling pathway mcal04218   Cellular senescence mcal04620   Toll-like receptor signaling pathway mcal04621   NOD-like receptor signaling pathway mcal04623   Cytosolic DNA-sensing pathway mcal04625   C-type lectin receptor signaling pathway mcal04630   JAK-STAT signaling pathway mcal04640   Hematopoietic cell lineage mcal04657   IL-17 signaling pathway mcal04659   Th17 cell differentiation mcal04668   TNF signaling pathway mcal04672   Intestinal immune network for IgA production mcal04931   Insulin resistance mcal04932   Non-alcoholic fatty liver disease mcal04933   AGE-RAGE signaling pathway in diabetic complications mcal04936   Alcoholic liver disease mcal05010   Alzheimer disease mcal05020   Prion disease mcal05022   Pathways of neurodegeneration - multiple diseases mcal05132   Salmonella infection mcal05133   Pertussis mcal05134   Legionellosis mcal05135   Yersinia infection mcal05142   Chagas disease mcal05143   African trypanosomiasis mcal05144   Malaria mcal05146   Amoebiasis mcal05152   Tuberculosis mcal05161   Hepatitis B mcal05162   Measles mcal05163   Human cytomegalovirus infection mcal05164   Influenza A mcal05166   Human T-cell leukemia virus 1 infection mcal05167   Kaposi sarcoma-associated herpesvirus infection mcal05168   Herpes simplex virus 1 infection mcal05169   Epstein-Barr virus infection mcal05171   Coronavirus disease - COVID-19 mcal05200   Pathways in cancer mcal05202   Transcriptional misregulation in cancer mcal05321   Inflammatory bowel disease mcal05323   Rheumatoid arthritis mcal05332   Graft-versus-host disease mcal05410   Hypertrophic cardiomyopathy mcal05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110295330 (Il6)    04668 TNF signaling pathway     110295330 (Il6)    04066 HIF-1 signaling pathway     110295330 (Il6)    04068 FoxO signaling pathway     110295330 (Il6)    04151 PI3K-Akt signaling pathway     110295330 (Il6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110295330 (Il6)    04061 Viral protein interaction with cytokine and cytokine receptor     110295330 (Il6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     110295330 (Il6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     110295330 (Il6)    04620 Toll-like receptor signaling pathway     110295330 (Il6)    04621 NOD-like receptor signaling pathway     110295330 (Il6)    04623 Cytosolic DNA-sensing pathway     110295330 (Il6)    04625 C-type lectin receptor signaling pathway     110295330 (Il6)    04659 Th17 cell differentiation     110295330 (Il6)    04657 IL-17 signaling pathway     110295330 (Il6)    04672 Intestinal immune network for IgA production     110295330 (Il6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110295330 (Il6)    05202 Transcriptional misregulation in cancer     110295330 (Il6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110295330 (Il6)    05161 Hepatitis B     110295330 (Il6)    05171 Coronavirus disease - COVID-19     110295330 (Il6)    05164 Influenza A     110295330 (Il6)    05162 Measles     110295330 (Il6)    05168 Herpes simplex virus 1 infection     110295330 (Il6)    05163 Human cytomegalovirus infection     110295330 (Il6)    05167 Kaposi sarcoma-associated herpesvirus infection     110295330 (Il6)    05169 Epstein-Barr virus infection     110295330 (Il6)   09171 Infectious disease: bacterial    05132 Salmonella infection     110295330 (Il6)    05135 Yersinia infection     110295330 (Il6)    05133 Pertussis     110295330 (Il6)    05134 Legionellosis     110295330 (Il6)    05152 Tuberculosis     110295330 (Il6)   09174 Infectious disease: parasitic    05146 Amoebiasis     110295330 (Il6)    05144 Malaria     110295330 (Il6)    05142 Chagas disease     110295330 (Il6)    05143 African trypanosomiasis     110295330 (Il6)   09163 Immune disease    05323 Rheumatoid arthritis     110295330 (Il6)    05321 Inflammatory bowel disease     110295330 (Il6)    05332 Graft-versus-host disease     110295330 (Il6)   09164 Neurodegenerative disease    05010 Alzheimer disease     110295330 (Il6)    05020 Prion disease     110295330 (Il6)    05022 Pathways of neurodegeneration - multiple diseases     110295330 (Il6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110295330 (Il6)    05410 Hypertrophic cardiomyopathy     110295330 (Il6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110295330 (Il6)    04932 Non-alcoholic fatty liver disease     110295330 (Il6)    04931 Insulin resistance     110295330 (Il6)    04933 AGE-RAGE signaling pathway in diabetic complications     110295330 (Il6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110295330 (Il6)    01523 Antifolate resistance     110295330 (Il6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcal04052]     110295330 (Il6) Cytokines and neuropeptides [BR:mcal04052]  Cytokines   Interleukins    110295330 (Il6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 ELMO_CED12 IL23 Motif Other DBs NCBI-GeneID:  110295330 NCBI-ProteinID:  XP_021019503 Ensembl:  MGP_CAROLIEiJ_G0027048 UniProt:  A0A6P5PTK2 LinkDB All DBs Position 5:24578778..24585357 Genome browser AA seq 211 aa AA seqDB search MKFLSARDFHPVGFLGLMLVTTTAFPTPQVRKGDFTEDTTPNRPVYTTSQVGGLITHVLW EIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEY HIYLEYMKNNLKDNKKEKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLMDKLES QKEWLKTKTIQFILKSLEEFLKVTLRSTRQA NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atgaagttcctttctgcaagagacttccatccagttggcttcttgggactgatgctggtg acaaccacggccttccctactccacaagtccggaaaggagacttcacagaggataccact cccaacagacctgtctataccacttcacaagtcggaggcttaattacacatgttctctgg gaaatcgtggaaatgagaaaagagttgtgcaatggcaattctgattgtatgaacaacgat gatgcacttgcagaaaacaatctgaaacttccagagatacaaagaaatgatggatgctac caaactggatacaatcaggaaatttgcctattgaaaatttcctctggtcttctggagtac catatctacctggagtacatgaagaacaacttaaaagataacaagaaagagaaagccaga gtccttcagagagatacagaaactctaattcatatcttcaatcaagaggtaaaagattta cataaaatagtccttcctaccccaatttccaatgctctcctaatggataagctggagtca cagaaggagtggctaaaaaccaagaccatccaattcatcttgaaatcacttgaagaattt ctaaaagtcactttgagatctactcggcaagcctag

DBGET integrated database retrieval system