Mus caroli (Ryukyu mouse): 110303320 Help Entry 110303320         CDS       T05910                                  Symbol Rap1b Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04010   MAPK signaling pathway mcal04014   Ras signaling pathway mcal04015   Rap1 signaling pathway mcal04024   cAMP signaling pathway mcal04062   Chemokine signaling pathway mcal04510   Focal adhesion mcal04520   Adherens junction mcal04611   Platelet activation mcal04670   Leukocyte transendothelial migration mcal04720   Long-term potentiation mcal04722   Neurotrophin signaling pathway mcal04934   Cushing syndrome mcal04972   Pancreatic secretion mcal05211   Renal cell carcinoma mcal05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110303320 (Rap1b)    04014 Ras signaling pathway     110303320 (Rap1b)    04015 Rap1 signaling pathway     110303320 (Rap1b)    04024 cAMP signaling pathway     110303320 (Rap1b)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     110303320 (Rap1b)    04520 Adherens junction     110303320 (Rap1b)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     110303320 (Rap1b)    04670 Leukocyte transendothelial migration     110303320 (Rap1b)    04062 Chemokine signaling pathway     110303320 (Rap1b)   09154 Digestive system    04972 Pancreatic secretion     110303320 (Rap1b)   09156 Nervous system    04720 Long-term potentiation     110303320 (Rap1b)    04722 Neurotrophin signaling pathway     110303320 (Rap1b)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     110303320 (Rap1b)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110303320 (Rap1b)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     110303320 (Rap1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110303320 (Rap1b)    04031 GTP-binding proteins [BR:mcal04031]     110303320 (Rap1b) Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110303320 (Rap1b)   Exosomal proteins of other body fluids (saliva and urine)    110303320 (Rap1b)   Exosomal proteins of colorectal cancer cells    110303320 (Rap1b) GTP-binding proteins [BR:mcal04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     110303320 (Rap1b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  110303320 NCBI-ProteinID:  XP_021030062 Ensembl:  MGP_CAROLIEiJ_G0015839 UniProt:  A0A6P5QB19 LinkDB All DBs Position 10:complement(110605537..110638081) Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatataagctcgtcgtgcttggctcaggaggcgttgggaagtcagccctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcttggataccgcagga acggagcagttcacagccatgagggacctgtacatgaagaacggacaaggcttcgctctg gtttactccatcacagcacagtcgacatttaacgacttacaagatctaagagagcagatt ctgcgggttaaagacactgatgatgttccaatgattctggttggtaataaatgcgacttg gaagatgaaagagttgtaggaaaggaacaaggtcagaacctagcaagacagtggaacaac tgtgcattcttagaatcctctgcaaagtccaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcatcg tgtcagctgctttaa

DBGET integrated database retrieval system