Mus caroli (Ryukyu mouse): 110306748 Help Entry 110306748         CDS       T05910                                  Symbol Max Name (RefSeq) protein max isoform X3   KO K04453   Max protein Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal03083   Polycomb repressive complex mcal04010   MAPK signaling pathway mcal05200   Pathways in cancer mcal05202   Transcriptional misregulation in cancer mcal05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:mcal00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     110306748 (Max)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110306748 (Max)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110306748 (Max)    05202 Transcriptional misregulation in cancer     110306748 (Max)   09162 Cancer: specific types    05222 Small cell lung cancer     110306748 (Max)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mcal03000]     110306748 (Max)    03036 Chromosome and associated proteins [BR:mcal03036]     110306748 (Max) Transcription factors [BR:mcal03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     110306748 (Max) Chromosome and associated proteins [BR:mcal03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      110306748 (Max) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HLH Filament bZIP_2 JetA SlyX Jnk-SapK_ap_N SLX9 DUF5595 GAGA_bind ATG16 DUF4763 Csm1_N Motif Other DBs NCBI-GeneID:  110306748 NCBI-ProteinID:  XP_021034488 Ensembl:  MGP_CAROLIEiJ_G0017874 UniProt:  A0A6P5QYP5 LinkDB All DBs Position 12:complement(71456607..71498219) Genome browser AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGGTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaagcgggctcaccataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagcaacagagtatatccagtatatgcgaaggaaaaaccatacg caccagcaagacattgatgacctcaagcggcagaatgctcttctggagcaacaagtccgt gcactggagaaggcaagatcaagtgcccaactgcagaccaactatccctcctcagacaac agcctctacaccaacgccaagggcggcaccatctctgccttcgatgggggttcagactcc agctcagagtccgagcctgaagagccccagagcaggaagaaactccggatggaggccagc taa

DBGET integrated database retrieval system