Mus caroli (Ryukyu mouse): 110307063 Help Entry 110307063         CDS       T05910                                  Symbol Fos Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal01522   Endocrine resistance mcal04010   MAPK signaling pathway mcal04024   cAMP signaling pathway mcal04210   Apoptosis mcal04380   Osteoclast differentiation mcal04620   Toll-like receptor signaling pathway mcal04657   IL-17 signaling pathway mcal04658   Th1 and Th2 cell differentiation mcal04659   Th17 cell differentiation mcal04660   T cell receptor signaling pathway mcal04662   B cell receptor signaling pathway mcal04668   TNF signaling pathway mcal04713   Circadian entrainment mcal04725   Cholinergic synapse mcal04728   Dopaminergic synapse mcal04915   Estrogen signaling pathway mcal04917   Prolactin signaling pathway mcal04921   Oxytocin signaling pathway mcal04926   Relaxin signaling pathway mcal04928   Parathyroid hormone synthesis, secretion and action mcal04932   Non-alcoholic fatty liver disease mcal04935   Growth hormone synthesis, secretion and action mcal05031   Amphetamine addiction mcal05132   Salmonella infection mcal05133   Pertussis mcal05135   Yersinia infection mcal05140   Leishmaniasis mcal05142   Chagas disease mcal05161   Hepatitis B mcal05162   Measles mcal05166   Human T-cell leukemia virus 1 infection mcal05167   Kaposi sarcoma-associated herpesvirus infection mcal05170   Human immunodeficiency virus 1 infection mcal05171   Coronavirus disease - COVID-19 mcal05200   Pathways in cancer mcal05207   Chemical carcinogenesis - receptor activation mcal05208   Chemical carcinogenesis - reactive oxygen species mcal05210   Colorectal cancer mcal05224   Breast cancer mcal05231   Choline metabolism in cancer mcal05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mcal05323   Rheumatoid arthritis mcal05417   Lipid and atherosclerosis mcal05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110307063 (Fos)    04668 TNF signaling pathway     110307063 (Fos)    04024 cAMP signaling pathway     110307063 (Fos)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     110307063 (Fos)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110307063 (Fos)    04660 T cell receptor signaling pathway     110307063 (Fos)    04658 Th1 and Th2 cell differentiation     110307063 (Fos)    04659 Th17 cell differentiation     110307063 (Fos)    04657 IL-17 signaling pathway     110307063 (Fos)    04662 B cell receptor signaling pathway     110307063 (Fos)   09152 Endocrine system    04915 Estrogen signaling pathway     110307063 (Fos)    04917 Prolactin signaling pathway     110307063 (Fos)    04921 Oxytocin signaling pathway     110307063 (Fos)    04926 Relaxin signaling pathway     110307063 (Fos)    04935 Growth hormone synthesis, secretion and action     110307063 (Fos)    04928 Parathyroid hormone synthesis, secretion and action     110307063 (Fos)   09156 Nervous system    04725 Cholinergic synapse     110307063 (Fos)    04728 Dopaminergic synapse     110307063 (Fos)   09158 Development and regeneration    04380 Osteoclast differentiation     110307063 (Fos)   09159 Environmental adaptation    04713 Circadian entrainment     110307063 (Fos)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110307063 (Fos)    05207 Chemical carcinogenesis - receptor activation     110307063 (Fos)    05208 Chemical carcinogenesis - reactive oxygen species     110307063 (Fos)    05231 Choline metabolism in cancer     110307063 (Fos)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110307063 (Fos)   09162 Cancer: specific types    05210 Colorectal cancer     110307063 (Fos)    05224 Breast cancer     110307063 (Fos)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110307063 (Fos)    05170 Human immunodeficiency virus 1 infection     110307063 (Fos)    05161 Hepatitis B     110307063 (Fos)    05171 Coronavirus disease - COVID-19     110307063 (Fos)    05162 Measles     110307063 (Fos)    05167 Kaposi sarcoma-associated herpesvirus infection     110307063 (Fos)   09171 Infectious disease: bacterial    05132 Salmonella infection     110307063 (Fos)    05135 Yersinia infection     110307063 (Fos)    05133 Pertussis     110307063 (Fos)   09174 Infectious disease: parasitic    05140 Leishmaniasis     110307063 (Fos)    05142 Chagas disease     110307063 (Fos)   09163 Immune disease    05323 Rheumatoid arthritis     110307063 (Fos)   09165 Substance dependence    05031 Amphetamine addiction     110307063 (Fos)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110307063 (Fos)    05418 Fluid shear stress and atherosclerosis     110307063 (Fos)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     110307063 (Fos)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     110307063 (Fos)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mcal03000]     110307063 (Fos)    04131 Membrane trafficking [BR:mcal04131]     110307063 (Fos) Transcription factors [BR:mcal03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     110307063 (Fos) Membrane trafficking [BR:mcal04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     110307063 (Fos) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  110307063 NCBI-ProteinID:  XP_021034937 Ensembl:  MGP_CAROLIEiJ_G0017967 UniProt:  A0A6P5QZR1 LinkDB All DBs Position 12:79863165..79866563 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEASTPESEEAFT LPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETSRSVPDVDLSGSFYA ADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPGCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggtttcaacgccgactacgaggcgtcatcctcccgctgcagtagcgcc tccccggccggggacagcctttcctactaccattccccagccgactccttctccagcatg ggctctcctgtcaacacacaggacttttgcgcagatctgtccgtctctagtgccaacttt atccccacggtgacagccatctccaccagcccagacctgcagtggctggtgcagcccact ctggtctcctccgtggccccctctcagaccagagcgccccatccttacggactccccacc cagtctgctggggcttacgccagagcgggaatggtgaagaccgtgtcaggaggcagagcg cagagcatcggcagaaggggcaaagtagagcagctatctcctgaagaggaagagaaacgg agaatccgaagggaacggaataagatggctgcagccaagtgccggaatcggaggagggag ctgacagatacgctccaagcggagacagatcaacttgaagatgagaagtctgcgttgcag actgaaattgccaatctgctgaaagagaaggaaaaactggagtttattttggcagcccac cgacctgcctgcaagatccccgatgacctcggcttcccagaggagatgtctgtggcctcc ctggatttgactggaggtctgcctgaggcttccaccccagagtctgaggaggccttcacc ctgccccttctcaacgaccctgagcccaagccatccttggagccagtcaagagcatcagc aacgtggagctgaaggctgaaccctttgatgacttcttgtttccggcatcatctaggccc agtggctcggagacctcccgctctgtgccagatgtggacctgtccggttccttctatgca gcagactgggagcctctgcacagcagttccctggggatggggcccatggtcacagagctg gagcccctgtgtactcccgtggtcacctgtactccaggctgcactacttacacgtcttcc tttgtcttcacctaccccgaggctgactccttcccaagctgtgccgctgcccaccgaaag ggcagcagcagcaacgagccctcctccgactccctgagctcacccacactgctggccctg tga

DBGET integrated database retrieval system