KEGG   Macaca fascicularis (crab-eating macaque): 102128755
Entry
102128755         CDS       T02918                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00250  Alanine, aspartate and glutamate metabolism
mcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102128755 (RIMKLA)
Enzymes [BR:mcf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     102128755 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     102128755 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 Dala_Dala_lig_C ATP-grasp CPSase_L_D2 Rimk_N Synapsin_C TTL
Other DBs
NCBI-GeneID: 102128755
NCBI-ProteinID: XP_005543807
Ensembl: ENSMFAG00000044165
UniProt: A0A2K5VKU1
LinkDB
Position
1:complement(180763108..180800815)
AA seq 391 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGHLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPNRQTGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINSGSTSSESEPELGEIRD
SSASTMGAPPSMLSEPGYNINNRIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatccgcgaggactacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
ctcatggaccagatcgccgtcaccatcgtcggcggccacctcggcctccagttaaaccag
aaggccctcaccaccttcccggatgtagtgcttgtgcgggtacccacaccctcagtgcag
tcagacagtgacatcactgtcctgcgacacctggagaagctgggctgccggttggtcaat
cgcccacagagcatcttaaattgcatcaacaaattctggacgttccaagaactggctgga
catggggtccccatgccagacaccttctcctatggtgggcatgaagacttttcaaaaatg
atcgatgaagccgagcccctgggctacccagttgtggtgaagagcacacgaggccaccgg
ggaaaagctgtttttctggcaagagataaacatcacctctctgacatctgccatctgatc
cgccacgatgtgccctacctgttccagaagtacgtgaaggagtcccatggaaaggacatc
cgggtggtggtggtagggggccaggtcataggctccatgcttcgctgctccactgatgga
cggatgcagagcaactgctctctcggtggcgtgggtgtcatgtgcccgctgacagaacaa
ggcaagcagttggctattcaggtgtccaacatcctaggcatggacttctgtggcattgat
ctccttatcatggacgatggctcctttgtggtgtgtgaggcaaacgctaatgttggcttc
ctagccttcgaccaggcatgcaacttagatgtgggtgggatcattgcagactataccatg
tccttgctgccaaacaggcagactggaaagatggctgtcctcccaggactgtcgagtccg
agggagaagaacgagccggatggctgtgcgtcagctcagggagttgcagagagcgtctac
accatcaacagtgggtctacctctagcgaaagtgagcctgaactgggagagatccgggat
tcctcagcaagcacaatgggggccccaccctccatgctgtccgaacctggctacaacatt
aacaacaggattgcttctgaattaaaacttaagtga

DBGET integrated database retrieval system