Alexandromys fortis (reed vole): 126504830 Help Entry 126504830         CDS       T08493                                  Name (RefSeq) caspase-3 isoform X1   KO K02187   caspase 3 [EC:3.4.22.56] Organism mfot  Alexandromys fortis (reed vole) Pathway mfot01524   Platinum drug resistance mfot04010   MAPK signaling pathway mfot04115   p53 signaling pathway mfot04148   Efferocytosis mfot04210   Apoptosis mfot04215   Apoptosis - multiple species mfot04623   Cytosolic DNA-sensing pathway mfot04650   Natural killer cell mediated cytotoxicity mfot04657   IL-17 signaling pathway mfot04668   TNF signaling pathway mfot04726   Serotonergic synapse mfot04932   Non-alcoholic fatty liver disease mfot04933   AGE-RAGE signaling pathway in diabetic complications mfot04936   Alcoholic liver disease mfot05010   Alzheimer disease mfot05012   Parkinson disease mfot05014   Amyotrophic lateral sclerosis mfot05016   Huntington disease mfot05020   Prion disease mfot05022   Pathways of neurodegeneration - multiple diseases mfot05132   Salmonella infection mfot05133   Pertussis mfot05134   Legionellosis mfot05145   Toxoplasmosis mfot05146   Amoebiasis mfot05152   Tuberculosis mfot05160   Hepatitis C mfot05161   Hepatitis B mfot05162   Measles mfot05163   Human cytomegalovirus infection mfot05164   Influenza A mfot05165   Human papillomavirus infection mfot05167   Kaposi sarcoma-associated herpesvirus infection mfot05168   Herpes simplex virus 1 infection mfot05169   Epstein-Barr virus infection mfot05170   Human immunodeficiency virus 1 infection mfot05200   Pathways in cancer mfot05203   Viral carcinogenesis mfot05205   Proteoglycans in cancer mfot05206   MicroRNAs in cancer mfot05210   Colorectal cancer mfot05222   Small cell lung cancer mfot05416   Viral myocarditis mfot05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     126504830    04668 TNF signaling pathway     126504830  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     126504830   09143 Cell growth and death    04210 Apoptosis     126504830    04215 Apoptosis - multiple species     126504830    04115 p53 signaling pathway     126504830  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     126504830    04650 Natural killer cell mediated cytotoxicity     126504830    04657 IL-17 signaling pathway     126504830   09156 Nervous system    04726 Serotonergic synapse     126504830  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     126504830    05206 MicroRNAs in cancer     126504830    05205 Proteoglycans in cancer     126504830    05203 Viral carcinogenesis     126504830   09162 Cancer: specific types    05210 Colorectal cancer     126504830    05222 Small cell lung cancer     126504830   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     126504830    05161 Hepatitis B     126504830    05160 Hepatitis C     126504830    05164 Influenza A     126504830    05162 Measles     126504830    05168 Herpes simplex virus 1 infection     126504830    05163 Human cytomegalovirus infection     126504830    05167 Kaposi sarcoma-associated herpesvirus infection     126504830    05169 Epstein-Barr virus infection     126504830    05165 Human papillomavirus infection     126504830   09171 Infectious disease: bacterial    05132 Salmonella infection     126504830    05133 Pertussis     126504830    05134 Legionellosis     126504830    05152 Tuberculosis     126504830   09174 Infectious disease: parasitic    05146 Amoebiasis     126504830    05145 Toxoplasmosis     126504830   09164 Neurodegenerative disease    05010 Alzheimer disease     126504830    05012 Parkinson disease     126504830    05014 Amyotrophic lateral sclerosis     126504830    05016 Huntington disease     126504830    05020 Prion disease     126504830    05022 Pathways of neurodegeneration - multiple diseases     126504830   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     126504830    05416 Viral myocarditis     126504830   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     126504830    04932 Non-alcoholic fatty liver disease     126504830    04933 AGE-RAGE signaling pathway in diabetic complications     126504830   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     126504830  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mfot01002]     126504830 Enzymes [BR:mfot01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      126504830 Peptidases and inhibitors [BR:mfot01002]  Cysteine peptidases   Family C14: caspase family    126504830 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 aRib Motif Other DBs NCBI-GeneID:  126504830 NCBI-ProteinID:  XP_050003335 LinkDB All DBs Position Unknown AA seq 277 aa AA seqDB search MENNETAVDSKSINNFEVKTIHGSKSMDSGMYLDNSYKMDYPEMGVCIIINNKNFHKSTG MTPRSGTDVDAAKLRETFMSLKYEVRNKNDLTREEIVELMDKVSKEDHSKRSSFVCVILS HGDEGIIFGTNGPVDLKKLTSYFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSATDD DMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKLHAHKLEFMHILTRVN LKVATEFESFSHDSTFHAKKQFPCIVSMLTKELYFYH NT seq 834 nt NT seq  +upstreamnt  +downstreamnt atggagaacaacgaaaccgcagtggattccaaatccattaataattttgaagtaaagacc atacatggaagcaaatcaatggattctggaatgtatctggacaatagttacaaaatggat tatcctgaaatgggtgtgtgtataataatcaataataagaactttcataaaagcactgga atgacacctcgctctggtactgacgttgatgcagccaaactcagagagacattcatgagc ctgaaatacgaagtccggaataagaatgatcttactcgtgaagaaattgtggaattgatg gataaagtctctaaagaggaccacagcaagaggagcagttttgtttgtgtgattctaagc catggtgacgaaggaatcatttttggaaccaatggccccgttgacctaaaaaagttaact agttacttcagaggtgactactgccgaagtctaacggggaaacccaaactcttcatcatt caggcctgccggggtacggagctggactgtggcattgagacagacagcgcgactgatgat gatatggcgtgccagaagatcccggtggaagccgacttcctgtacgcttactccacagca cccggttactactcctggagaaattcaaaggacgggtcctggttcatccagtcactttgc gccatgctgaagctgcatgcacacaagcttgagtttatgcacatcctcactcgcgttaac ctgaaggttgcgacagaatttgagtccttctcccatgactccactttccatgcaaagaaa cagtttccatgcattgtgtctatgctcacaaaagaactctacttttatcactaa

DBGET integrated database retrieval system