Manis javanica (Malayan pangolin): 108389793 Help Entry 108389793         CDS       T06054                                  Symbol CASP3 Name (RefSeq) caspase-3   KO K02187   caspase 3 [EC:3.4.22.56] Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01524   Platinum drug resistance mjv04010   MAPK signaling pathway mjv04115   p53 signaling pathway mjv04148   Efferocytosis mjv04210   Apoptosis mjv04215   Apoptosis - multiple species mjv04623   Cytosolic DNA-sensing pathway mjv04650   Natural killer cell mediated cytotoxicity mjv04657   IL-17 signaling pathway mjv04668   TNF signaling pathway mjv04726   Serotonergic synapse mjv04932   Non-alcoholic fatty liver disease mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv04936   Alcoholic liver disease mjv05010   Alzheimer disease mjv05012   Parkinson disease mjv05014   Amyotrophic lateral sclerosis mjv05016   Huntington disease mjv05020   Prion disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05132   Salmonella infection mjv05133   Pertussis mjv05134   Legionellosis mjv05145   Toxoplasmosis mjv05146   Amoebiasis mjv05152   Tuberculosis mjv05160   Hepatitis C mjv05161   Hepatitis B mjv05162   Measles mjv05163   Human cytomegalovirus infection mjv05164   Influenza A mjv05165   Human papillomavirus infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05168   Herpes simplex virus 1 infection mjv05169   Epstein-Barr virus infection mjv05170   Human immunodeficiency virus 1 infection mjv05200   Pathways in cancer mjv05203   Viral carcinogenesis mjv05205   Proteoglycans in cancer mjv05206   MicroRNAs in cancer mjv05210   Colorectal cancer mjv05222   Small cell lung cancer mjv05416   Viral myocarditis mjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108389793 (CASP3)    04668 TNF signaling pathway     108389793 (CASP3)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     108389793 (CASP3)   09143 Cell growth and death    04210 Apoptosis     108389793 (CASP3)    04215 Apoptosis - multiple species     108389793 (CASP3)    04115 p53 signaling pathway     108389793 (CASP3)  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     108389793 (CASP3)    04650 Natural killer cell mediated cytotoxicity     108389793 (CASP3)    04657 IL-17 signaling pathway     108389793 (CASP3)   09156 Nervous system    04726 Serotonergic synapse     108389793 (CASP3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108389793 (CASP3)    05206 MicroRNAs in cancer     108389793 (CASP3)    05205 Proteoglycans in cancer     108389793 (CASP3)    05203 Viral carcinogenesis     108389793 (CASP3)   09162 Cancer: specific types    05210 Colorectal cancer     108389793 (CASP3)    05222 Small cell lung cancer     108389793 (CASP3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108389793 (CASP3)    05161 Hepatitis B     108389793 (CASP3)    05160 Hepatitis C     108389793 (CASP3)    05164 Influenza A     108389793 (CASP3)    05162 Measles     108389793 (CASP3)    05168 Herpes simplex virus 1 infection     108389793 (CASP3)    05163 Human cytomegalovirus infection     108389793 (CASP3)    05167 Kaposi sarcoma-associated herpesvirus infection     108389793 (CASP3)    05169 Epstein-Barr virus infection     108389793 (CASP3)    05165 Human papillomavirus infection     108389793 (CASP3)   09171 Infectious disease: bacterial    05132 Salmonella infection     108389793 (CASP3)    05133 Pertussis     108389793 (CASP3)    05134 Legionellosis     108389793 (CASP3)    05152 Tuberculosis     108389793 (CASP3)   09174 Infectious disease: parasitic    05146 Amoebiasis     108389793 (CASP3)    05145 Toxoplasmosis     108389793 (CASP3)   09164 Neurodegenerative disease    05010 Alzheimer disease     108389793 (CASP3)    05012 Parkinson disease     108389793 (CASP3)    05014 Amyotrophic lateral sclerosis     108389793 (CASP3)    05016 Huntington disease     108389793 (CASP3)    05020 Prion disease     108389793 (CASP3)    05022 Pathways of neurodegeneration - multiple diseases     108389793 (CASP3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108389793 (CASP3)    05416 Viral myocarditis     108389793 (CASP3)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     108389793 (CASP3)    04932 Non-alcoholic fatty liver disease     108389793 (CASP3)    04933 AGE-RAGE signaling pathway in diabetic complications     108389793 (CASP3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     108389793 (CASP3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mjv01002]     108389793 (CASP3) Enzymes [BR:mjv01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      108389793 (CASP3) Peptidases and inhibitors [BR:mjv01002]  Cysteine peptidases   Family C14: caspase family    108389793 (CASP3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 Motif Other DBs NCBI-GeneID:  108389793 NCBI-ProteinID:  XP_036852437 LinkDB All DBs Position Unknown AA seq 277 aa AA seqDB search METSENSVDSKSIKNSETKIFHGSKSVDSGIFLDSSYKMDYPEMGLCVIINNKNFDESTG MQSRPGTDVDAADLRETFTNLKYEVRNKNDLTCEQIMELMYSVSKEDHSKRSSFICVLLS HGDEGVIFGTDGPIDLKKLTRFFRGDCCRSLTGKPKLFIIQACRGTELDSGIETDSSAQD DMGCQKIPVEADFLYAYSTAPGYYSWRNSRNGSWFIQSLCTMLKQYAHKLEVIHILTRVN RKVAIEFESYSLDSALHAKKQIPCIVSMLTKELYFYH NT seq 834 nt NT seq  +upstreamnt  +downstreamnt atggagaccagtgaaaactcagtggattcaaaatccattaaaaattcagaaacaaagatc tttcatggaagcaagtcagtggactctggaatattcttggacagtagttacaaaatggat tatcctgaaatgggtttatgtgtaataattaataataagaactttgatgaaagtactgga atgcagtctcggcctggtacagatgttgatgcagcagacctcagggaaacattcacaaac ttgaaatatgaagtcaggaataaaaatgatcttacatgcgagcaaattatggaattgatg tacagtgtttctaaagaagatcatagcaaaaggagcagtttcatttgcgtgctactaagc catggtgatgaaggagtaatttttggaacagatggacctattgacctgaaaaaattaaca cgtttcttcagaggggattgttgtagaagtctaactggaaaacccaaacttttcattatt caggcctgccgaggtacagaactggactctggtattgagactgacagtagtgctcaggat gacatggggtgtcagaaaataccagttgaggccgacttcttgtatgcatattctacagca cctggttactattcctggcgaaattcaaggaatggatcctggttcatccagtcactctgt actatgctcaaacagtacgctcacaaacttgaggttatacacatccttactcgggttaac cggaaagtagcaatagaatttgagtcttactctcttgattccgctcttcatgcaaagaaa cagattccatgtattgtgtctatgctcacaaaagaactgtatttttatcactaa

DBGET integrated database retrieval system