Mandrillus leucophaeus (drill): 105552669 Help Entry 105552669         CDS       T08763                                  Name (RefSeq) caspase-3-like   KO K02187   caspase 3 [EC:3.4.22.56] Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu01524   Platinum drug resistance mleu04010   MAPK signaling pathway mleu04115   p53 signaling pathway mleu04148   Efferocytosis mleu04210   Apoptosis mleu04215   Apoptosis - multiple species mleu04623   Cytosolic DNA-sensing pathway mleu04650   Natural killer cell mediated cytotoxicity mleu04657   IL-17 signaling pathway mleu04668   TNF signaling pathway mleu04726   Serotonergic synapse mleu04932   Non-alcoholic fatty liver disease mleu04933   AGE-RAGE signaling pathway in diabetic complications mleu04936   Alcoholic liver disease mleu05010   Alzheimer disease mleu05012   Parkinson disease mleu05014   Amyotrophic lateral sclerosis mleu05016   Huntington disease mleu05020   Prion disease mleu05022   Pathways of neurodegeneration - multiple diseases mleu05132   Salmonella infection mleu05133   Pertussis mleu05134   Legionellosis mleu05145   Toxoplasmosis mleu05146   Amoebiasis mleu05152   Tuberculosis mleu05160   Hepatitis C mleu05161   Hepatitis B mleu05162   Measles mleu05163   Human cytomegalovirus infection mleu05164   Influenza A mleu05165   Human papillomavirus infection mleu05167   Kaposi sarcoma-associated herpesvirus infection mleu05168   Herpes simplex virus 1 infection mleu05169   Epstein-Barr virus infection mleu05170   Human immunodeficiency virus 1 infection mleu05200   Pathways in cancer mleu05203   Viral carcinogenesis mleu05205   Proteoglycans in cancer mleu05206   MicroRNAs in cancer mleu05210   Colorectal cancer mleu05222   Small cell lung cancer mleu05416   Viral myocarditis mleu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105552669    04668 TNF signaling pathway     105552669  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     105552669   09143 Cell growth and death    04210 Apoptosis     105552669    04215 Apoptosis - multiple species     105552669    04115 p53 signaling pathway     105552669  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     105552669    04650 Natural killer cell mediated cytotoxicity     105552669    04657 IL-17 signaling pathway     105552669   09156 Nervous system    04726 Serotonergic synapse     105552669  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105552669    05206 MicroRNAs in cancer     105552669    05205 Proteoglycans in cancer     105552669    05203 Viral carcinogenesis     105552669   09162 Cancer: specific types    05210 Colorectal cancer     105552669    05222 Small cell lung cancer     105552669   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105552669    05161 Hepatitis B     105552669    05160 Hepatitis C     105552669    05164 Influenza A     105552669    05162 Measles     105552669    05168 Herpes simplex virus 1 infection     105552669    05163 Human cytomegalovirus infection     105552669    05167 Kaposi sarcoma-associated herpesvirus infection     105552669    05169 Epstein-Barr virus infection     105552669    05165 Human papillomavirus infection     105552669   09171 Infectious disease: bacterial    05132 Salmonella infection     105552669    05133 Pertussis     105552669    05134 Legionellosis     105552669    05152 Tuberculosis     105552669   09174 Infectious disease: parasitic    05146 Amoebiasis     105552669    05145 Toxoplasmosis     105552669   09164 Neurodegenerative disease    05010 Alzheimer disease     105552669    05012 Parkinson disease     105552669    05014 Amyotrophic lateral sclerosis     105552669    05016 Huntington disease     105552669    05020 Prion disease     105552669    05022 Pathways of neurodegeneration - multiple diseases     105552669   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105552669    05416 Viral myocarditis     105552669   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105552669    04932 Non-alcoholic fatty liver disease     105552669    04933 AGE-RAGE signaling pathway in diabetic complications     105552669   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     105552669  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mleu01002]     105552669 Enzymes [BR:mleu01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      105552669 Peptidases and inhibitors [BR:mleu01002]  Cysteine peptidases   Family C14: caspase family    105552669 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 RST Motif Other DBs NCBI-GeneID:  105552669 NCBI-ProteinID:  XP_011853791 LinkDB All DBs Position Unknown AA seq 168 aa AA seqDB search MDYPEMGLCIIINNKNFHKSTRMTSRSGTDVDAANLRETFINLKYEVRNKNDLTREEIVE LMRNVSGEDHSKRRSFVCVLLSHSEEGISFGTNGPVDLKKITSFFRGDCCGSLTGKPKLF IIQACCGTELDCGIETDSGVEDDMACHKIPVEADFLYAYSTSPGYYSW NT seq 507 nt NT seq  +upstreamnt  +downstreamnt atggattatcctgagatgggtttatgtataataattaataataagaattttcataaaagc actcgaatgacatctcggtctggtacagatgttgatgcagcaaacctcagggaaacattc ataaacttgaaatatgaagtcaggaataaaaacgatcttacacgtgaagaaattgtggaa ttgatgcgcaatgtttctggagaagatcacagcaaaaggcgcagttttgtttgtgtgctt ctgagccatagtgaagaaggaataagttttggaacaaatggacctgttgacctgaaaaaa ataacaagctttttcagaggggattgttgtggaagtctaactggaaaacccaaacttttc attattcaggcctgctgtggtacagaactggactgtggcattgagacagacagtggtgtt gaggatgacatggcgtgtcataaaataccagtggaggccgacttcttgtatgcatactcc acatcacctggttattattcttggtga

DBGET integrated database retrieval system