Myotis lucifugus (little brown bat): 102438419 Help Entry 102438419         CDS       T07795                                  Symbol CASP3 Name (RefSeq) caspase-3 isoform X3   KO K02187   caspase 3 [EC:3.4.22.56] Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf01524   Platinum drug resistance mlf04010   MAPK signaling pathway mlf04115   p53 signaling pathway mlf04148   Efferocytosis mlf04210   Apoptosis mlf04215   Apoptosis - multiple species mlf04623   Cytosolic DNA-sensing pathway mlf04650   Natural killer cell mediated cytotoxicity mlf04657   IL-17 signaling pathway mlf04668   TNF signaling pathway mlf04726   Serotonergic synapse mlf04932   Non-alcoholic fatty liver disease mlf04933   AGE-RAGE signaling pathway in diabetic complications mlf04936   Alcoholic liver disease mlf05010   Alzheimer disease mlf05012   Parkinson disease mlf05014   Amyotrophic lateral sclerosis mlf05016   Huntington disease mlf05020   Prion disease mlf05022   Pathways of neurodegeneration - multiple diseases mlf05132   Salmonella infection mlf05133   Pertussis mlf05134   Legionellosis mlf05145   Toxoplasmosis mlf05146   Amoebiasis mlf05152   Tuberculosis mlf05160   Hepatitis C mlf05161   Hepatitis B mlf05162   Measles mlf05163   Human cytomegalovirus infection mlf05164   Influenza A mlf05165   Human papillomavirus infection mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05168   Herpes simplex virus 1 infection mlf05169   Epstein-Barr virus infection mlf05170   Human immunodeficiency virus 1 infection mlf05200   Pathways in cancer mlf05203   Viral carcinogenesis mlf05205   Proteoglycans in cancer mlf05206   MicroRNAs in cancer mlf05210   Colorectal cancer mlf05222   Small cell lung cancer mlf05416   Viral myocarditis mlf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102438419 (CASP3)    04668 TNF signaling pathway     102438419 (CASP3)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     102438419 (CASP3)   09143 Cell growth and death    04210 Apoptosis     102438419 (CASP3)    04215 Apoptosis - multiple species     102438419 (CASP3)    04115 p53 signaling pathway     102438419 (CASP3)  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     102438419 (CASP3)    04650 Natural killer cell mediated cytotoxicity     102438419 (CASP3)    04657 IL-17 signaling pathway     102438419 (CASP3)   09156 Nervous system    04726 Serotonergic synapse     102438419 (CASP3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102438419 (CASP3)    05206 MicroRNAs in cancer     102438419 (CASP3)    05205 Proteoglycans in cancer     102438419 (CASP3)    05203 Viral carcinogenesis     102438419 (CASP3)   09162 Cancer: specific types    05210 Colorectal cancer     102438419 (CASP3)    05222 Small cell lung cancer     102438419 (CASP3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102438419 (CASP3)    05161 Hepatitis B     102438419 (CASP3)    05160 Hepatitis C     102438419 (CASP3)    05164 Influenza A     102438419 (CASP3)    05162 Measles     102438419 (CASP3)    05168 Herpes simplex virus 1 infection     102438419 (CASP3)    05163 Human cytomegalovirus infection     102438419 (CASP3)    05167 Kaposi sarcoma-associated herpesvirus infection     102438419 (CASP3)    05169 Epstein-Barr virus infection     102438419 (CASP3)    05165 Human papillomavirus infection     102438419 (CASP3)   09171 Infectious disease: bacterial    05132 Salmonella infection     102438419 (CASP3)    05133 Pertussis     102438419 (CASP3)    05134 Legionellosis     102438419 (CASP3)    05152 Tuberculosis     102438419 (CASP3)   09174 Infectious disease: parasitic    05146 Amoebiasis     102438419 (CASP3)    05145 Toxoplasmosis     102438419 (CASP3)   09164 Neurodegenerative disease    05010 Alzheimer disease     102438419 (CASP3)    05012 Parkinson disease     102438419 (CASP3)    05014 Amyotrophic lateral sclerosis     102438419 (CASP3)    05016 Huntington disease     102438419 (CASP3)    05020 Prion disease     102438419 (CASP3)    05022 Pathways of neurodegeneration - multiple diseases     102438419 (CASP3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102438419 (CASP3)    05416 Viral myocarditis     102438419 (CASP3)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102438419 (CASP3)    04932 Non-alcoholic fatty liver disease     102438419 (CASP3)    04933 AGE-RAGE signaling pathway in diabetic complications     102438419 (CASP3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102438419 (CASP3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mlf01002]     102438419 (CASP3) Enzymes [BR:mlf01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      102438419 (CASP3) Peptidases and inhibitors [BR:mlf01002]  Cysteine peptidases   Family C14: caspase family    102438419 (CASP3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 Motif Other DBs NCBI-GeneID:  102438419 NCBI-ProteinID:  XP_006092748 Ensembl:  ENSMLUG00000002451 LinkDB All DBs Position Unknown AA seq 293 aa AA seqDB search MPQHGRTDQKYLIKVSMDNTDDSVDSKSIKNSDIKPFHGSKSMDSGISLDDTYKMDYPEM GLCIIINNKNFDKSTGMASRSGTDVDAANLRETFTKLKYEVRNKNDLTREEIVELMCSVS KEDHSKRSSFVCVLLSHGDEGIIFGTNGPVDLRKLTIFFRGDYCRSLAGKPKLFIIQACR GTELDCGIETDSNIDDDMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLK LYSHKLELMHILTRVNRKVATEFESFSFDSTFHAKKQIPCIVSMLTKELYFYH NT seq 882 nt NT seq  +upstreamnt  +downstreamnt atgcctcagcatggaaggactgaccagaaatacttaataaaagtatccatggataacact gatgactcagtggattcaaagtccatcaagaattcggacataaagcccttccatggcagc aaatccatggactctgggatatccttggacgatacttacaagatggattatcctgaaatg ggcttatgcatcataatcaataataagaactttgataaaagcactggaatggcatctcgg tcgggtacagatgttgatgcagcaaacctcagggaaacattcacaaaattgaaatacgaa gtcaggaacaaaaatgatcttacccgcgaggaaattgtggaactgatgtgcagcgtttct aaagaagatcatagcaaaaggagcagttttgtttgcgtgcttctaagccatggtgacgaa ggaataatttttggaacaaatggacctgttgacctgagaaaattaacaatttttttccga ggggattactgtagaagtctagctggaaagcccaaacttttcattattcaggcctgccga ggaacagaactggactgcggtattgagactgacagcaatattgatgatgacatggcatgt cagaaaataccagtggaggcagacttcttgtatgcatattctacagcacctggttactac tcctggcgaaattcaaaggatggatcctggttcatccagtcgctttgtgcgatgctgaag ctgtactcgcacaagctggagctcatgcacatcctcactcgggttaaccggaaggtagcc acagaatttgagtccttctcctttgactctacttttcacgcaaagaaacagattccatgc attgtgtctatgctcacaaaagaactgtatttttatcactaa

DBGET integrated database retrieval system