KEGG   Mus musculus (house mouse): 194237
Entry
194237            CDS       T01002                                 
Symbol
Rimkla, B930030J24, NAAGS, NAAGS-II, Rimk
Name
(RefSeq) ribosomal modification protein rimK-like family member A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00250  Alanine, aspartate and glutamate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    194237 (Rimkla)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     194237 (Rimkla)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     194237 (Rimkla)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp CPSase_L_D2 Dala_Dala_lig_C Synapsin_C Rimk_N TTL
Other DBs
NCBI-GeneID: 194237
NCBI-ProteinID: NP_808240
MGI: 3040686
Ensembl: ENSMUSG00000048899
UniProt: Q6PFX8
LinkDB
Position
4:complement(119322480..119349795)
AA seq 380 aa
MCAQVWLLTDRLIREDYPQVQILRALRQRCSEQDVGFRAVFLDQIAVTVVGGHLGLQLSQ
KPLTTFPDVVVVRVSTPSVQSDSEITILRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLV
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCFLGGVGVKCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFTVCEANANVGFLAFDQACNLDVGAIIADYAM
SLLPNRQTGKMAILPGLASPREKNEPNGCVSAQGVAESVYAITNGSTSSESEPELGEARD
SSVKTMGAPPAHVAQAWLQH
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgtgcgcgcaggtctggctgctgaccgaccggctcatccgcgaggactacccgcaggtg
cagatcctgcgcgcgctccgccagcgctgctcggagcaggacgtgggtttccgggcggtg
ttcctggaccagatcgccgtcaccgtcgtcggcggccacctaggcctgcagctgagccag
aaacccctgaccaccttccccgacgtggtggttgttcgagtatccacaccctctgtccag
tcggatagtgagatcaccatcctgaggcacctggagaagctgggctgccgcttggtcaac
cgtcctcaaagcatcttaaactgcatcaacaagttttggacattccaagagctggctgga
catggggtccccatgccagacaccttctcctatggtgggcacgaagacttctctaaaatg
atcgatgaagctgagcccctgggctacccagtggtggtgaagagcacacgggggcaccgg
gggaaagctgtttttctggccagagacaagcatcacctctctgacatctgccacctagtc
cgccatgatgtgccctacctgttccagaagtatgtgaaagagtcgcacgggaaggacatc
cgggtggtggtggtgggtggccaggtgattggctccatgctgcgctgctccacagacggc
cgcatgcaaagcaactgctttctaggtggtgtgggtgtcaagtgcccactgaccgagcaa
ggcaagcagctggctatccaggtgtccaacatcctgggcatggatttctgtggcatcgac
cttcttatcatggatgacggctccttcacggtgtgtgaggccaacgccaatgtcggcttc
ctggccttcgaccaggcatgcaacttagatgtgggggcaatcattgcagactatgctatg
tccctgctgccaaacaggcagactgggaagatggccatcctcccgggactggcaagtccc
agggagaagaacgagccaaatggttgcgtttcagctcagggagttgcagagagtgtctat
gccatcaccaatgggtctacctctagtgagagtgagcctgaactgggagaggcccgggat
tcctcagtaaaaacaatgggggccccgcctgcgcatgttgcccaagcctggttacagcat
taa

DBGET integrated database retrieval system