KEGG   Microcebus murinus (gray mouse lemur): 105867374
Entry
105867374         CDS       T07238                                 

Name
(RefSeq) LOW QUALITY PROTEIN: cytochrome P450 11B2, mitochondrial-like
  KO
K07433  steroid 11beta-monooxygenase / corticosterone 18-monooxygenase [EC:1.14.15.4 1.14.15.5]
Organism
mmur  Microcebus murinus (gray mouse lemur)
Pathway
mmur00140  Steroid hormone biosynthesis
mmur01100  Metabolic pathways
mmur04925  Aldosterone synthesis and secretion
Module
mmur_M00108  C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
Brite
KEGG Orthology (KO) [BR:mmur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    105867374
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    105867374
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmur00199]
    105867374
Enzymes [BR:mmur01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     105867374
    1.14.15.5  corticosterone 18-monooxygenase
     105867374
Cytochrome P450 [BR:mmur00199]
 Cytochrome P450, animal type
  CYP11 family
   105867374
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105867374
NCBI-ProteinID: XP_012612806
VGNC: 82047
LinkDB
Position
9:114223759..114231634
AA seq 503 aa
MAFRAKAGVWMAGXWLSLRGPRALHQSSLRPRRCWPFEAIPQSRHNNWMRTLQFWKGQGY
ENLHLEMHQNFQELGPIFRYDTGGTRTVSVMLPEDVERLQEVESLHPRRMLVEPWLAYRQ
HRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQKYIPMVDMVARDFSQALKEKVLQNAR
GSLTLDIQPSIFYYTIEASNSALFGERLGLLGNNPSYASLKFIHALEAMFKSTVQLMYMP
RSLSRWTSTKTWEEHFEAWDYIYQYGDKCIQKTYSELVGGCPSQHYRSVLAELLLHADLS
PDAIKANAIELTAGSVDTTSFPLLMTFFELARNPDVQQALRQESLAAQASITDNPQRALV
ELPLLRAALKETLRLYPVGLFLERLLSSDMVLQNYHIPAGTLVQVFLHSLGRHSASFPRP
ERYEPQRWLEVKGSSTNFRHVAFGFGVRQCLGRRLAEVEMLLLLHHVLKTFLVETLNQED
VRMVYRFILRPTALPLLTFRAIN
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggcattcagggcaaaggcaggcgtgtggatggcaggcnnctggctgtctctgcgaggg
ccacgggcactgcaccagagctctctgcgcccaaggcggtgctggcccttcgaagccata
ccccagagtcgccacaacaactggatgaggacgctgcagttctggaaggggcagggctat
gagaaccttcacctggagatgcatcagaacttccaggagctggggcccattttcaggtat
gacacaggaggaacacgaacggtgtctgtgatgctgccggaggacgtggagagactgcag
gaggtggagagtctgcacccacgccggatgctcgtggagccctggctggcctacagacaa
caccgggggcacaaatgtggcgtgttcttgctgaacgggcctgaatggcgcttcaaccga
ttgcggctgaacccagatgtgctgtcgccaaaggccgtccagaagtatattcccatggtg
gatatggtggcaagggatttctcccaggccctgaaggagaaggtgctacagaatgcccgg
ggcagcctgaccctggacatccagcccagcatcttctactacaccatagaagccagcaac
tcagcactttttggagagcggctgggcctccttggcaataaccccagctatgccagcctg
aagttcatccatgccctggaggccatgttcaaatccaccgtacagctcatgtacatgccc
aggagcctgtcccgctggaccagcaccaagacgtgggaagagcactttgaggcctgggac
tacatctaccagtatggtgacaaatgcatccagaaaacctattcagagctggtaggtggc
tgcccttctcaacactatcgcagtgtccttgcagagctgttgttgcatgcagacttgtca
ccagatgccatcaaagccaatgccattgaactcacagcagggagtgtggacacgacctcc
ttccccttgctgatgacattcttcgagctggctcgcaaccctgacgtgcagcaggcccta
cgccaggagagcctggcagcccaggccagcatcactgacaatccccagagggcattggtg
gagctgcccctgctgcgggccgccctcaaggagaccctgaggctctaccccgtgggtctc
ttcctggagcgactcctgtcctcagacatggtgctgcagaactaccacatcccagctggg
acactggtccaggtgttcctccattcgctgggtcgccactccgcctccttcccgaggcca
gagcgctatgagccccagcgctggctagaggtcaagggttccagcacaaacttccgccac
gtggcctttggctttggcgtgcgccagtgcctggggcggcgcctggcagaggtggagatg
ctgctcctgctgcaccacgtgctgaaaaccttcctggtggagacactaaaccaagaggat
gtaaggatggtgtaccgcttcatattgaggcccactgctctccccctcctcaccttcagg
gccattaactag

DBGET integrated database retrieval system