KEGG   Miniopterus natalensis: 107538982
Entry
107538982         CDS       T05883                                 

Gene name
C2
Definition
(RefSeq) complement C2
  KO
K01332  complement component 2 [EC:3.4.21.43]
Organism
mna  Miniopterus natalensis
Pathway
mna04610  Complement and coagulation cascades
mna05133  Pertussis
mna05150  Staphylococcus aureus infection
mna05171  Coronavirus disease - COVID-19
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    107538982 (C2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107538982 (C2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107538982 (C2)
   05150 Staphylococcus aureus infection
    107538982 (C2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107538982 (C2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107538982 (C2)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.43  classical-complement-pathway C3/C5 convertase
     107538982 (C2)
Peptidases and inhibitors [BR:mna01002]
 Serine peptidases
  Family S1: chymotrypsin family
   107538982 (C2)
SSDB
Motif
Pfam: VWA Trypsin Sushi VWA_2 DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 107538982
NCBI-ProteinID: XP_016070820
LinkDB
Position
Unknown
AA seq 750 aa
MGSLGALLCLLPLYAGVAAAAPSCPQNVKISGGNFTLSHGWGPGSVLIYSCPLGWYPLPA
SRLCLSNGRWRTPRSTQLRKAVCKPVRCPAPVSFENGMYTPRLGSHPVGGNLSFECEDGF
VLRGSPVRHCRPNGMWDGETAVCDNGAGHCPDPGISVGSVRTGSRFGLGDKVSYRCSVNL
VLTGSAERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSLSHLLGSTNPTQKKKESV
GRKIQIQRSGHLNLYLLLDASQSVKEEDFSIFKDSAILMVDRIFSFEINVSVAIITFASK
PKVIMSVLQDSSRDVTEVINSLEKINYKDHENGTGTNIRGALNSVYIMMNNQMQRLGMNT
VAWQEIRHAIILLTDGKSNMGGSPKEAVDNIKEILSINQKRTDYLDIYAIGVGRLDVDWR
ELNELGSKKDGERHAFILQDTKALYQVFEHMLDVSRLIDTICGVGNMSANASAQERTPWH
VTIKPKSRETCRGALISDQWVLTAAHCFHHDNDHSLWRVIVGDPNSHLGKEFQIEKVVIS
SGFDISAKKHQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTVGANLALRRPPGSTCR
DHESELLNKLSIPAHFVALNGGKLNINLKTGTEWTRCIEVVSQYKTAFPNLTDVGEVVTD
QFLCSGMESDDNPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCDSSRENSRKRAPKGRV
PPPRDFHINLFRLQPWLRQHLEGVLNFLPL
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgggctcactcggggctctgctttgcctgctgcccctgtacgcaggcgtggctgcagct
gcaccctcctgcccccagaacgtgaagatctctggtggcaatttcaccctcagccatggc
tggggcccggggagcgtcctcatctactcctgccccctgggctggtacccactccccgca
tccagactgtgcctgagcaacggccggtggcgcaccccgagatccacccagctgagaaag
gcggtctgcaaacctgttcgctgcccagcccctgtttcctttgagaatggcatgtacacc
ccacggctggggtcccaccctgtgggcggcaacctgagcttcgagtgcgaggatggcttc
gtgctgcggggctcacccgtgcggcactgtcgccccaacggcatgtgggacggggagacg
gctgtgtgtgacaatggcgctggccactgccccgacccgggcatttccgtgggctctgtg
cggactgggtcccgatttggccttggggacaaggtcagctaccgctgctccgtgaatctg
gtgctgacagggtctgcagagcgggagtgccagggcaacggggtctggagtgggaccgag
cccatctgccgccaaccctactcttacgactttcctgaggacgtggcccctgccctgggc
acctctttgtcccacctgcttggatccaccaaccccacccagaagaagaaggaaagcgtg
ggccgaaaaatccaaatccagcgatctggtcacctgaacctctacctgctcctggatgcc
tctcagagtgtgaaagaggaagacttcagtatcttcaaggacagtgccatcctcatggtg
gacaggatcttcagctttgagatcaacgtgagtgtcgccatcatcaccttcgcatcaaag
ccgaaagtcatcatgtctgtcctgcaggacagctcccgagatgtgaccgaagtgatcaac
agtctggaaaaaatcaactacaaagaccatgaaaatgggaccgggaccaacatccgtggg
gccctaaatagtgtctatatcatgatgaataaccaaatgcagcgcctgggcatgaacacg
gtggcctggcaggaaatccgacatgccatcatccttctgacagatggaaagtccaatatg
ggggggtctcccaaggaagctgttgacaatatcaaagagatcttaagcatcaaccagaag
aggaccgactacctggacatctatgccatcggggtgggcaggctggatgtggactggagg
gagctgaacgagctgggatccaagaaggacggcgagaggcatgccttcatcctgcaggac
acaaaggctctgtaccaggtctttgagcacatgctcgatgtctcccggctcatagacacc
atatgtggggtggggaatatgtcagctaatgcatctgcccaggagaggacaccctggcat
gtcactatcaagcccaagagccgggagacctgccggggggccctcatctccgaccagtgg
gtcctgacagctgctcactgcttccatcacgacaatgaccattccctgtggagggtcatt
gtgggggatcccaactcccatttgggcaaagagttccagattgagaaggtggtgatctcc
tctggctttgatatctctgccaagaagcatcaggggatcctggagttctatggtgatgac
attgccctgctgaagctagctcagaaagtgaagatgtccacccatgccaggcccatctgc
cttccctgcacggtgggggccaatctggctctgcggagacccccaggcagcacttgccga
gatcacgagagcgaactgctgaacaaactgagcattcctgctcacttcgtggccttgaat
gggggcaaactgaacattaacctcaagacagggacagagtggacaaggtgtattgaggtg
gtctcccaatacaaaactgcgttccccaacttgacagatgtcggagaggtggtgacagac
cagttcctatgcagtgggatggagagtgatgataatccctgcaagggagaatctggggga
gcagttttccttgagcgcagattcaggtttttccaggtgggcctggtaagctggggtctc
tacaacccctgtgacagttccagagaaaactcccgcaagagagcccccaagggcagggtc
cccccaccccgtgattttcacatcaatctcttccgcctgcaaccctggctgaggcagcac
ctggagggcgtcctgaactttttgcccctgtaa

DBGET integrated database retrieval system