Microtus oregoni (creeping vole): 121433874 Help Entry 121433874         CDS       T08307                                  Symbol Casp3 Name (RefSeq) caspase-3   KO K02187   caspase 3 [EC:3.4.22.56] Organism morg  Microtus oregoni (creeping vole) Pathway morg01524   Platinum drug resistance morg04010   MAPK signaling pathway morg04115   p53 signaling pathway morg04148   Efferocytosis morg04210   Apoptosis morg04215   Apoptosis - multiple species morg04623   Cytosolic DNA-sensing pathway morg04650   Natural killer cell mediated cytotoxicity morg04657   IL-17 signaling pathway morg04668   TNF signaling pathway morg04726   Serotonergic synapse morg04932   Non-alcoholic fatty liver disease morg04933   AGE-RAGE signaling pathway in diabetic complications morg04936   Alcoholic liver disease morg05010   Alzheimer disease morg05012   Parkinson disease morg05014   Amyotrophic lateral sclerosis morg05016   Huntington disease morg05020   Prion disease morg05022   Pathways of neurodegeneration - multiple diseases morg05132   Salmonella infection morg05133   Pertussis morg05134   Legionellosis morg05145   Toxoplasmosis morg05146   Amoebiasis morg05152   Tuberculosis morg05160   Hepatitis C morg05161   Hepatitis B morg05162   Measles morg05163   Human cytomegalovirus infection morg05164   Influenza A morg05165   Human papillomavirus infection morg05167   Kaposi sarcoma-associated herpesvirus infection morg05168   Herpes simplex virus 1 infection morg05169   Epstein-Barr virus infection morg05170   Human immunodeficiency virus 1 infection morg05200   Pathways in cancer morg05203   Viral carcinogenesis morg05205   Proteoglycans in cancer morg05206   MicroRNAs in cancer morg05210   Colorectal cancer morg05222   Small cell lung cancer morg05416   Viral myocarditis morg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121433874 (Casp3)    04668 TNF signaling pathway     121433874 (Casp3)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     121433874 (Casp3)   09143 Cell growth and death    04210 Apoptosis     121433874 (Casp3)    04215 Apoptosis - multiple species     121433874 (Casp3)    04115 p53 signaling pathway     121433874 (Casp3)  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     121433874 (Casp3)    04650 Natural killer cell mediated cytotoxicity     121433874 (Casp3)    04657 IL-17 signaling pathway     121433874 (Casp3)   09156 Nervous system    04726 Serotonergic synapse     121433874 (Casp3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121433874 (Casp3)    05206 MicroRNAs in cancer     121433874 (Casp3)    05205 Proteoglycans in cancer     121433874 (Casp3)    05203 Viral carcinogenesis     121433874 (Casp3)   09162 Cancer: specific types    05210 Colorectal cancer     121433874 (Casp3)    05222 Small cell lung cancer     121433874 (Casp3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121433874 (Casp3)    05161 Hepatitis B     121433874 (Casp3)    05160 Hepatitis C     121433874 (Casp3)    05164 Influenza A     121433874 (Casp3)    05162 Measles     121433874 (Casp3)    05168 Herpes simplex virus 1 infection     121433874 (Casp3)    05163 Human cytomegalovirus infection     121433874 (Casp3)    05167 Kaposi sarcoma-associated herpesvirus infection     121433874 (Casp3)    05169 Epstein-Barr virus infection     121433874 (Casp3)    05165 Human papillomavirus infection     121433874 (Casp3)   09171 Infectious disease: bacterial    05132 Salmonella infection     121433874 (Casp3)    05133 Pertussis     121433874 (Casp3)    05134 Legionellosis     121433874 (Casp3)    05152 Tuberculosis     121433874 (Casp3)   09174 Infectious disease: parasitic    05146 Amoebiasis     121433874 (Casp3)    05145 Toxoplasmosis     121433874 (Casp3)   09164 Neurodegenerative disease    05010 Alzheimer disease     121433874 (Casp3)    05012 Parkinson disease     121433874 (Casp3)    05014 Amyotrophic lateral sclerosis     121433874 (Casp3)    05016 Huntington disease     121433874 (Casp3)    05020 Prion disease     121433874 (Casp3)    05022 Pathways of neurodegeneration - multiple diseases     121433874 (Casp3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121433874 (Casp3)    05416 Viral myocarditis     121433874 (Casp3)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     121433874 (Casp3)    04932 Non-alcoholic fatty liver disease     121433874 (Casp3)    04933 AGE-RAGE signaling pathway in diabetic complications     121433874 (Casp3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     121433874 (Casp3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:morg01002]     121433874 (Casp3) Enzymes [BR:morg01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      121433874 (Casp3) Peptidases and inhibitors [BR:morg01002]  Cysteine peptidases   Family C14: caspase family    121433874 (Casp3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 aRib Motif Other DBs NCBI-GeneID:  121433874 NCBI-ProteinID:  XP_041488471 LinkDB All DBs Position Unknown AA seq 277 aa AA seqDB search MENNETAVDSKSINDFEVKTIHGSKSMDSGMYMDNSYKMDYPEMGVCIIINNKNFHKSTG MTPRSGTDVDAANLRETFMSLKYEVRNKNDLTREEIVELMDKVSKEDHSKRSSFVCVILS HGDEGIIFGTNGPVDLKKLTSYFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSATDD DMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKLHAHKLEFMHILTRVN RKVATEFESFSHDSTFHAKKQIPCIVSMLTKELYFYH NT seq 834 nt NT seq  +upstreamnt  +downstreamnt atggagaacaacgaaaccgcagtggattccaaatccattaatgattttgaagtaaagacc atacatggaagcaaatcaatggattctggaatgtatatggacaatagttacaaaatggat tatcctgaaatgggtgtgtgtataataatcaataataagaactttcataaaagcactgga atgacacctcgctctggtactgacgttgatgcagccaacctcagagagacattcatgagc ctgaagtatgaagtccggaataagaatgatcttactcgtgaagagattgtggaattgatg gataaagtctctaaagaggaccacagcaagaggagcagttttgtttgtgtgattctaagc catggtgatgaaggaatcatttttggaaccaatgggcccgttgacctaaaaaagttaact agttacttcagaggtgactactgccgaagtctaacgggaaaacccaaactcttcatcatt caggcctgccggggtacggagctggactgtggcattgagacagacagtgcgactgatgat gatatggcgtgccagaagatcccagtggaagccgacttcctgtacgcttactccacagca cccggttactactcctggagaaactcaaaggacgggtcctggttcatccagtcactttgc gccatgctgaagctgcatgcacacaagcttgagttcatgcacatcctcactcgcgtgaac cggaaggtagcgacagaatttgagtccttctcccatgactccactttccatgcaaagaaa cagattccatgcattgtgtctatgctcacaaaagaactctacttttatcactaa

DBGET integrated database retrieval system