KEGG   Mus pahari (shrew mouse): 110323614
Entry
110323614         CDS       T05929                                 
Symbol
Rimkla
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00250  Alanine, aspartate and glutamate metabolism
mpah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110323614 (Rimkla)
Enzymes [BR:mpah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     110323614 (Rimkla)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     110323614 (Rimkla)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp Dala_Dala_lig_C CPSase_L_D2 Synapsin_C Rimk_N TTL
Other DBs
NCBI-GeneID: 110323614
NCBI-ProteinID: XP_021056595
Ensembl: MGP_PahariEiJ_G0028730
LinkDB
Position
6:complement(70597244..70622115)
AA seq 379 aa
MCAQVWLLTDRLIREDYPQVQIRALRQRCSEQDVGFRAVFLDQIAVTVVGGHLGLQLSQK
PLTTFPDVVVVRVSTPSVQSDSEITILRHLEKLGCRLVNRPQSILNCINKFWTFQELAGH
GVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLVR
HDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCFLGGVGVKCPLTEQG
KQLAIQVSNILGMDFCGIDLLIMDDGSFMVCEANANVGFLAFDQACNLDVGAIIADYAMS
LLPNRQTGKMAILPGLASPREKNEPNGCVSAQGVAESVYAITNGSTSSESEPELGEARDS
SAKTMGAPPVHVARTWLQH
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtgcgcgcaggtctggctgctgaccgaccggctcatccgcgaggactacccgcaggtg
cagatccgcgcactccgccagcgctgctccgagcaggacgtgggtttccgggcggtgttc
ctggaccagatcgccgtcaccgtcgtcggcggccacctaggcctgcagctgagccagaaa
cccctgaccaccttccccgacgtggtggtggttcgagtatccacaccctctgtccagtcg
gatagtgagatcaccatcctgaggcacctggagaagctgggctgccgcttggtcaaccgt
cctcaaagcatcttaaactgcatcaacaagttttggacattccaagagctggctggacat
ggggtccccatgccagacaccttctcctatggtgggcacgaagacttctctaaaatgatc
gatgaagccgagcccctgggctacccagtggtggtgaagagcacacgggggcaccgggga
aaagctgtttttctggccagagacaagcatcacctctctgacatctgccacctggtccgc
cacgacgtgccctacctgtttcagaagtacgtgaaggagtcacacgggaaggacatccgg
gtggtggtggtgggcggccaggtgatcggctccatgctgcgctgctccacagatggccgc
atgcaaagcaactgctttctaggtggtgtgggtgtcaagtgcccactgaccgagcaaggc
aagcagctggctatccaggtgtccaacatcctgggcatggatttctgtggcatcgacctt
cttatcatggatgacggctccttcatggtgtgtgaggccaatgccaatgtcggcttcctg
gccttcgaccaggcatgcaacttagatgtgggggcaatcattgcagactatgctatgtcc
ctgctgccaaacaggcagactgggaagatggccatcctcccgggactggcaagtcccagg
gagaagaatgagccaaatggttgcgtttcagcccagggagttgcagagagtgtctatgcc
atcaccaatgggtctacctctagtgagagtgagcctgaactgggagaggcccgggattcc
tcagcaaaaacaatgggggccccacctgtgcatgttgcccgaacctggctacagcattaa

DBGET integrated database retrieval system