KEGG   Mus pahari (shrew mouse): 110330483
Entry
110330483         CDS       T05929                                 

Gene name
Evc2
Definition
(RefSeq) limbin
  KO
K19608  ellis van creveld syndrome protein 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110330483 (Evc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110330483 (Evc2)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    110330483 (Evc2)
SSDB
Motif
Pfam: EVC2_like
Other DBs
NCBI-GeneID: 110330483
NCBI-ProteinID: XP_021066271
Ensembl: MGP_PahariEiJ_G0016954
LinkDB
Position
13
AA seq 1220 aa
MEATGPTGAGGRATWVLAGNILAAALVLGAGPLALPPSFPAPGPGSPSLPGPAGPRANPQ
YSDISREAQGSSENGVIFQKCSLVSGQSESQTMHVQLSVNNTRTPTSANLSDLLVLDEIT
GLTVKESPGNNTQDGIQTFRKSFLQVGECYSVSYMASLDPTALGTGESLDLPARLIFQSP
SQNRTQLKAHFAITVEEKIVVLPNHGLHAAGFIAAFLISLLLTLAALFFLVRDRCLQGGM
LSRCRVQHPENKLEPSPFTSANGVSQDLSLNDQVVAILTSEEPGSMLQALEELEIATLNQ
ADADLEACRNQISKDVIALLMKNLSSGSHLSPHTERKMAAAFKKQFLLLENEIQEEYERK
MLALTAECDLEMRKKTENQYQREMVAMEEAEEVLKRASERSTAECSSLLRTLHGLEQEDM
QRSLALCQAEDFAQAHRQLAVFQRNELHSIVYTQVQSAVAKGELRPEVAKMMLQDYSKTQ
ESVEELMDFFQATKRYHLSKRFGHREYLVQRLQAMETRVQGLLNTAATQLTSLIHKHERA
GYLDEDQMETLLERAQTETFSIKQKLDNDLKQEKKRLHQRLITKRRRELLQKHKEQQKEQ
VSLGEASSTAEDAVQYLQQWRSVMAEHTAALEELQERLDQAALDDLRVLTVSLSEKATEE
LRRLQSTAMTQELLKRSAPWLFLQQILEEHSRESAARTTQLEAEERERGQELVQGVRQRL
QQDAPEAYTEEQAELRHWEHLVFMKLCCAAISLSEEDLLRVKQEAQGCFSQLDRSLALPR
VRARVLQQQMQMAWREAEFRKLDQALAAPELQSKARKLRSKGRGKADLLKKTLEDKIRLF
EERAPVELADQVRGELLQERVQRLEAQEAHFAESLVALQFQKVARAAETLSVYTALLSIQ
DLLLGELSESETLTKSACVQILESHRPDLQELQELERKLEDQLVQQEEAEQQQVLESWQR
WAADGPGLSEPEELDPERQVSAVLRQALNKGQKLLEQHQQRVREEWQNSAVLEDSLESIE
ADTMASLCSQGLRLVSYLSRMTMVPGSTLLRLLSVVLPAASQPQLLALLDIVGEKHSDHT
AENESGGEQTHAEQGKRRRHQGWWKALDSRFRADLVSQGLERMLWARQKKESILKKIYVP
IREKVMFPGKGSWPHLSLEPIGELAPIPITGADTVDILNTGEKIFVFRSPKEPEISLRVP
PRRKKNFLNAKKANRALGLD
NT seq 3663 nt   +upstreamnt  +downstreamnt
atggaggcgacgggtcccacgggcgctgggggacgagccacgtgggtgctggctgggaat
atcctggccgcggccctggtgctgggcgcgggtcctcttgcacttccaccctccttccct
gccccgggcccagggtcaccatccctgcccggcccagcaggaccccgggcaaacccgcag
tacagcgatatttcaagagaagcccaaggttcctctgagaatggagtgatatttcaaaaa
tgctcactggtgtctgggcagagcgaatcgcagaccatgcacgtgcagctgtcagtgaac
aacaccaggacgcccacgtcagccaacctctcggacctgctcgtgctggatgagatcact
ggcctcactgtgaaggagtcgcctggcaacaatactcaggacggaatccagactttcaga
aagagctttctgcaagtgggagaatgctactctgtcagctacatggcctcgctggacccc
acagcccttgggactggagagagcctggatcttcctgcccggctcatctttcagagcccc
tcacagaacagaactcagctaaaagcccactttgccatcacagtggaagaaaagatagtg
gttctgcctaaccacggtctccacgcagcaggcttcatcgcagccttcctcatctccctc
ctcctgaccttggcagccctgttcttcctggtgagggatcgatgtctgcagggaggcatg
ctgtccagatgccgggttcagcatcctgagaacaagctggagccctcgcccttcacttct
gctaacggtgtgagccaggacctttccctcaatgaccaagtggttgccatcctgacttct
gaggagcctgggagcatgcttcaagccctagaagagttggagatcgcaaccctgaaccag
gcagatgcggacctggaggcttgtcggaaccagattagtaaggatgtcattgcccttctg
atgaagaatctgagcagtggcagtcacctctccccgcacacagaaaggaagatggccgct
gctttcaaaaagcagtttctgctgctggaaaatgaaatacaggaggagtatgagcggaag
atgttggcactgacagcagagtgtgacctagaaatgaggaagaagacagaaaaccagtac
cagagggagatggtggccatggaggaagcagaagaggtgctgaagagagctagcgagagg
tccactgcagagtgcagcagccttttgcggaccctccatgggctggagcaggaggacatg
cagaggtccctcgctctgtgccaagcagaggactttgcccaagcacacaggcagctggct
gttttccagaggaatgaattacacagcatcgtctatacccaggtacagagtgctgtcgcc
aaaggagaactgaggcccgaggtggctaaaatgatgctgcaagactattctaaaacacag
gagagtgtagaagagctgatggacttcttccaggccaccaagcgataccatctcagcaag
aggtttggccacagagagtacctggtccagagactgcaggccatggagacccgcgtgcaa
gggctgctgaacacggcggctacccagctaacaagcctcatccataaacatgagagggct
ggctacttggatgaagatcagatggaaacgctattggagcgtgcacagacagaaaccttt
tctataaaacagaagctggacaatgacttaaagcaggaaaagaaaaggctccaccaaaga
ttaataaccaagaggcggcgggaacttctgcagaagcacaaggagcagcagaaggagcag
gtgtcccttggcgaggcctccagcaccgcagaggatgcagtccagtacctgcagcagtgg
aggagcgtgatggccgagcacaccgctgccctggaggagctgcaggagcgtctggaccag
gctgccctggacgacctccgggtcctgactgtgtcgctgtccgagaaagccacggaggag
ctgaggcgcctgcagagcacggccatgacgcaggagctgctgaagcgcagtgctccctgg
ctcttcctgcagcagatcttagaggagcatagccgggagtctgcggctcgcaccacgcag
ctggaggcagaggagagggagcgtggccaggagctggtgcagggcgtgcggcagaggcta
cagcaggatgcaccggaggcctacacggaagagcaggcagagctgaggcactgggagcac
ttggtgttcatgaagctctgctgtgcggccatctcactgtctgaagaagacctgctccgg
gtgaagcaggaagcacagggctgcttcagccagctggaccggagcttggccctccccaga
gtccgtgcacgagtgttgcagcagcagatgcagatggcctggcgggaagcagagtttcgg
aaactggaccaggccttggctgcgcctgagctgcagtccaaggcaagaaagctgcgttcc
aagggcagaggcaaggccgatcttctgaagaagaccctggaagataagatccgcctattc
gaggagcgggcccctgtagaactggctgaccaggtgcgaggggaattgctccaagagagg
gtccagaggctggaggcccaggaggcgcactttgctgagtcacttgtggctctgcagttc
cagaaggtggcccgggctgctgagaccctctcggtctacaccgccctgctcagcattcaa
gacctgctgctgggggagctgagtgagtcggagacactgaccaagtcagcctgtgtgcag
atcctggagtcccacaggccggatctgcaggagctgcaggagctggagaggaagctggag
gaccagctggtgcagcaggaagaggctgagcagcagcaggtcctggagagctggcagcgg
tgggcagccgatggacctggactgagcgaacctgaggagctggatcctgaaaggcaggtc
tctgccgtcctgcggcaggccctgaacaagggccagaagctattggagcagcatcagcag
agggtgagagaggagtggcagaacagtgcggtgctggaagattctctggaaagcatagag
gctgacaccatggccagcctttgcagccagggactgaggctggtgtcatacctctcaagg
atgacaatggtgccagggagcacactgctgcgactcctgagtgtggtgcttccagcggct
tcgcagcctcagctactggccctgctggacatagtcggtgagaagcactcagaccacaca
gctgagaatgagagcggtggtgagcagactcacgcagagcagggcaagaggaggagacac
cagggctggtggaaagctttggacagcaggttcagagcagatctggtgagtcaaggactg
gaaaggatgctctgggcccgccagaagaaggagagcatactgaagaagatttacgtcccc
atccgggagaaggtgatgttccctgggaaaggaagctggcctcacctgtccctagagccc
attggagaactggctcccatccccatcactggggcagacaccgtggacatattaaacacg
ggagaaaagatctttgtattcagaagcccaaaggagcccgagatctcgttgcgtgttcct
cccaggaggaaaaagaatttcctgaatgccaagaaagccaacagggccttgggcttggac
tga

KEGG   Mus pahari (shrew mouse): 110330621
Entry
110330621         CDS       T05929                                 

Gene name
Evc
Definition
(RefSeq) ellis-van Creveld syndrome protein isoform X1
  KO
K19605  ellis van creveld syndrome protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110330621 (Evc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110330621 (Evc)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    110330621 (Evc)
SSDB
Motif
Pfam: ClpS
Other DBs
NCBI-GeneID: 110330621
NCBI-ProteinID: XP_021066522
Ensembl: MGP_PahariEiJ_G0016953
LinkDB
Position
13
AA seq 1003 aa
MTCTKDARLQLGREALQAAPTLLVPAVLLGGVLGLGLGLWLGCRASHLRARLQKDDRKHL
LRSSEPPAQSLRDTGSQARRRQRETTRDEDAPEVCEPSLSGNITAFALKARVVYPINQKF
RPLADGSSHPSLHENLTQVAAILPHLPHQPAEASPASSLGSLSQAGKEDASSSSSMRSTY
SDDRVLQYAFLRVGRFPEILACESVDIDLCVCSLHLKDLLQVDTALRQEKHLMFIQILKA
CLLDFFPKKKPDDELYQKILSKQERDLEELEKGLQARLANTEMLGTGDSGYVSLADVERK
ERELSEQLIDNMGAFWKQMESIQPILMDQFKCSSSKARQFMMTLTGRMIVAEGLLHDSQD
LHVLDTLERTMGRAHMARMVEFLRTQIQEETKCRLAAISRGLELLTVQGQLSGRQKEELL
TQQHKAFWEEAEHFGREFMQRGKDLVQASQARQAEASAELTQTQEEERRSFLADSQLTSD
PGEFLKAFHDVLERQRLTRSDQEGDEDTRITEAMAALCQELYCSTMGTFQKFVDSLFLKT
LPEVSSLPVAECEALRQQVQEQAARQLGQADRFRRRQWGLLCDLLEQDKRVWLEEGTLST
VLQRQLRDHHESTIQGVLSRFSGLSEESTRGILQGHELLLCSALRRLALRGTTITALAQM
RLSGKKRLLQELHEQLALEQGVSPCLEEHQWQLLRALEARIQEEAARLEDEAQQTSLRLQ
QQLLAEAQEAGRLLQLHSERAIGQALLVYARNAASKGRTREKEDFKRTLVETVVESVYVT
STSVNRLVQVHYQGIGKLLQAHEEQLLQRLKTLQGERINAYKLWKKQEFSDPSSESQTAD
GTHGASQAVQQRMLSQQKKLLDQLTKHQQGRLNAQRQKAHELDQLEAQLETQLQEAEQTL
ISELATLARVPLPENKPFSNKRGLPEKPVRTKRKKPPPREREDLGLPNNDHLALADHTTG
PLSTTYSASPPIHVHSGGRLGQQDSEAGDGESTRKILQKRSNL
NT seq 3012 nt   +upstreamnt  +downstreamnt
atgacctgcactaaagatgcgcggctgcagctgggccgggaagccctgcaagcggcgcct
acgctgctggtccccgcggtgctactgggtggcgttctcggcctaggccttggcttgtgg
cttggctgtcgcgcgagccacttgcgcgcgcggctccagaaagatgacaggaaacatctg
ctcaggagttcagagccccctgcacagagcctacgggacactggctctcaagccaggagg
cgccagagagaaaccactcgggatgaagatgcccctgaggtgtgtgagccatccttgagt
ggcaacatcacggcatttgcactgaaagccagagttgtctatcccatcaaccagaagttc
cggcctctggcggacggatcctcccacccatcgctgcatgaaaacttgacacaggtggcg
gccatcctgccccacctgccccaccagccagcagaggcctcgccagccagcagcctgggc
agcctgagccaggctggcaaggaggatgccagctcctcctctagcatgcggtcaacctac
agcgacgaccgggtcctccagtatgccttcctccgggtgggcagattccctgagattctg
gcctgtgagagtgtagacattgacctgtgtgtctgcagccttcacctgaaagacctgctt
caggtagacacggcgctgaggcaggagaagcacctgatgttcattcagattcttaaagca
tgcctcctggatttttttcctaaaaagaagcctgatgatgaattataccagaagattctt
tccaaacaagagcgtgatttggaggaactagaaaagggacttcaggccaggctggcgaac
acagagatgttaggcaccggcgactccggctatgtttccctggcagatgtggagaggaag
gagagagagctctcggagcagctcatagacaatatgggggctttctggaagcaaatggaa
agcatccagcccattctcatggaccagttcaagtgttccagctccaaagctcggcagttc
atgatgactctgacgggaagaatgattgtcgctgaaggactgctgcatgattctcaggac
ctgcatgtcctggacaccctcgagaggacaatgggtcgagcccacatggcaagaatggtt
gagttcctgaggacccagatccaggaggagaccaagtgcagacttgctgccatctcccgt
ggcctggagctgctgactgtccaggggcagctgtctgggaggcagaaggaggaactcctg
actcagcagcacaaggccttctgggaggaggcagagcactttggcagggaattcatgcag
cggggcaaagacctggtccaggcgtctcaggctcgccaggcagaggcatcagcagagctc
acacagacccaagaagaggaacggaggagtttcctggctgattcccagctgacctcagat
cccggggagttcctcaaggcttttcatgatgtcctggagaggcagcggctgacaaggagt
gaccaggagggagatgaggacacccggatcactgaggccatggctgcgctctgccaggag
ctgtactgtagcaccatgggaaccttccaaaagttcgtggactccttgttcctgaagacc
cttccagaagtgagcagcctccctgtggcagaatgtgaggccctgcggcaacaggtccag
gagcaggcagcaaggcagctgggacaggcggaccgattccgcagacgacagtggggactc
ctatgtgatctcttggagcaggacaaacgggtatggctggaggagggtaccctgtccacg
gtgctgcagaggcagctgcgggatcaccatgagagcaccatccaaggcgtcctgagccga
ttcagtggcctttccgaagagtccacgcgaggcatcctgcagggccacgagctgctgctc
tgctctgctctgcgcagactggccctccgaggcaccaccatcactgccctggctcagatg
cggctgtctgggaagaagaggctcctgcaggagctacatgagcagctggcgttagagcag
ggtgtgtccccgtgcctggaggagcatcagtggcagctgctcagagccctggaggcgcgg
atccaggaggaggcagccaggttggaggatgaggcgcagcagaccagtctgcggctccag
cagcagctgttggcggaggcacaggaggcagggcggctgctacagctgcactcggagcgg
gccattgggcaggcgctgctggtatatgctaggaatgcggccagcaaaggccggaccagg
gagaaggaagactttaagaggacgctggtggagacggtggtggaaagtgtgtatgtgacc
agcactagtgtcaaccgcctcgtgcaggtgcattaccagggcattgggaagctcctgcaa
gcccatgaggaacaattgctgcagcgcctgaagaccctgcagggggagagaatcaatgct
tacaagctgtggaagaagcaagaattcagtgacccgtcgtcggagagtcaaacagcggat
ggtacccacggagcttctcaggcggtacagcagaggatgctatcgcagcagaagaagctc
ctggaccagctcacaaagcaccagcagggccgtctgaatgctcagaggcagaaggcacac
gaactggaccagctggaagcccagcttgagacccagctgcaggaagctgagcagaccctt
atctcagagctagcgacattggcccgagtacccctacctgagaacaagccattctccaac
aagcgaggactgccagagaagccagtaaggaccaaaaggaagaagcccccacctcgggag
agagaggacctggggctacccaacaatgaccaccttgccttggccgaccacaccacagga
ccactcagtacaacctactcagcatcacctcccatccatgtccacagcggcggaaggctg
ggtcagcaggacagcgaagctggtgatggagaaagcacaaggaagatactgcagaaaaga
agcaatctgtaa

DBGET integrated database retrieval system