KEGG   Mus pahari (shrew mouse): 110336126
Entry
110336126         CDS       T05929                                 
Symbol
C2
Name
(RefSeq) complement C2 isoform X1
  KO
K01332  complement component 2 [EC:3.4.21.43]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah04936  Alcoholic liver disease
mpah05133  Pertussis
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110336126 (C2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110336126 (C2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110336126 (C2)
   05150 Staphylococcus aureus infection
    110336126 (C2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110336126 (C2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110336126 (C2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110336126 (C2)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.43  classical-complement-pathway C3/C5 convertase
     110336126 (C2)
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110336126 (C2)
SSDB
Motif
Pfam: VWA Trypsin Sushi VWA_2 HRM DUF1986 Longin_2
Other DBs
NCBI-GeneID: 110336126
NCBI-ProteinID: XP_021074213
Ensembl: MGP_PahariEiJ_G0020476
LinkDB
Position
18:complement(2780033..2799788)
AA seq 760 aa
MAPLLALFYLLQLGPGLAALSCTKNVNISGGNFTLSHGWAPGSLLIYSCPLGRYPSPAWR
KCQSNGQWQTPKSSSLFPLRSSRMVKAVCKPVRCLAPSSFENGIYFPRLVSYPVGSNVSF
ECAQGFTLRGSPMRYCRPNGLWDGETAVCDNGASHCPNPGISVGTARTGLSFELGDKVSY
RCSSSNMILTGSAERECQSNGAWSGSEPTCRQPYSYDFPEDVASALDTSFTNLLGATNPT
QVLLTKTLDRKIKVQRSGHLNLYLLLDASQSVSETDFDIFKNSALLMVDRIFSFEINVSV
AIITFASQPKIIMSVLSERSQDVTEVITSLQSASYKDHGLATGTNTYEALIHVSSMMQNQ
RDSLGMETSAWKEIRHTIILLTDGKSNMGGSPKAAVTRIRELLSIEQNREDYLDIYAIGV
GKLDVDWKELNELGSKKSGERHAFILQDAKAVQQIFEHMLDVSKLTDTICGVGNMSTNAS
NQERTPWQVTFKPKSKETCQGSLISDQWVLIAAHCFHDTQMEDRHLWRVTVGDPTSQRGK
EFLVEDVIIAPGFNVYAKRKQGISEFYADDIALLKLSSKVKMSTHARPICLPCTVGANMA
LRRPPGSTCKDHETELLSQQKVPAHFVALNGNRLNINLRTGPEWTRCIQAVSENKNIFPS
LTNVSEVVTEQFLCSGMEEGEDNPCKGESGGAVFLERRYRFFQVGLVSWGLFDPCHGSSN
KNVRKKPLHGVLPRDFHISLFRLQPWLRQHLGGVLDFLPL
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggcccctctgctggctctcttctacctgctgcagctgggcccaggtctggctgctctc
tcctgcaccaagaatgtcaatatctccggtggtaatttcaccctcagccatggctgggcc
cctgggagcctcctcatctactcctgccccctgggcaggtacccgtccccagcctggagg
aaatgccagagcaacgggcagtggcagacaccaaagtctagctcacttttccccctgcga
tcctctcggatggttaaagcagtctgcaaaccggttcgatgcctagctccttcatccttt
gagaatggcatctatttccctcggctggtgtcctaccctgtgggtagcaacgtgagcttc
gagtgtgctcaaggcttcaccttgcggggctcgcctatgcggtactgtcgccccaatggc
ctgtgggatggagagacggctgtgtgtgacaatggggctagccactgccccaaccctggc
atctcagtgggcacagctcggacaggcttgagctttgaacttggggacaaggtcagttac
cgctgctcctcctcaaatatgatattgaccggctctgcagagcgggagtgtcagagcaac
ggagcgtggagtgggtcggaacccacctgccgacagccttactcttatgacttccctgag
gatgtagcatctgccctggacacctccttcaccaacctgcttggagccaccaatcccacc
caggtccttctgacaaaaactttggaccgtaagatcaaagtccagcgctcgggtcacctg
aacctctatctgctgcttgatgcttctcagagtgtgtcagaaacagactttgacatcttc
aagaacagtgccttactcatggtggacaggatcttcagctttgagataaatgtcagcgta
gccatcatcacctttgcctctcagcccaaaatcatcatgtcggtcctgagtgagagatcc
caggatgtgacggaggtgatcaccagtctgcagtctgccagctacaaagatcacggactt
gccactggcactaacacttatgaggctctcatccatgtttcctccatgatgcaaaaccag
agggatagcctgggcatggagacctctgcctggaaggaaatccgccacaccatcatcctt
ctgactgacggcaagtccaacatgggtggctctcccaaggcagcggtcaccagaatcaga
gagctcctgagcatcgagcagaacagagaagactacctggacatctatgctatcggggtg
ggcaagctggatgtggactggaaagaactgaatgagctggggtccaagaagagtggcgag
aggcacgccttcatcttgcaggatgcaaaggccgtgcaacagatctttgagcacatgttg
gatgtctctaagctcacagataccatctgtggggtggggaacatgtccaccaatgcctct
aaccaggagaggacaccttggcaagtcacctttaagcccaagagcaaggaaacttgccag
gggtcgctcatctctgatcagtgggtgctgatagcagctcactgcttccatgacactcag
atggaggaccgccacctgtggagggtcaccgtgggtgatcccacctctcagcgtggcaaa
gaatttcttgtggaggatgtgatcattgccccagggtttaatgtctatgcaaagcggaag
cagggcatctcagagttctatgctgatgacattgccttgctgaagctatcttcgaaagtg
aaaatgtccacccatgccagacccatctgccttccttgcaccgtgggagccaacatggct
ctgcggagacccccaggtagtacctgtaaagaccatgagacagaacttctgtcacagcag
aaagttcctgcacattttgtagctttgaatgggaatagactgaacatcaacctcaggaca
ggacctgagtggacaaggtgtattcaggctgtctccgaaaacaagaacatcttccccagc
ttgacaaatgtcagcgaggtggtgacagagcagttcctatgcagtgggatggaggaggga
gaggacaatccttgcaaaggagaatctgggggagccgttttccttgagcggagatacagg
tttttccaggtgggcctggtgagttggggtcttttcgacccttgtcatggttcctccaac
aaaaacgtgcgcaagaaacctctgcatggtgttctgccgagggacttccacattagtctt
ttccgcctgcagccctggctgaggcagcacctgggtggtgtcctggactttctgccactg
taa

DBGET integrated database retrieval system