Muntiacus reevesi (Reeves' muntjac): 136176683 Help Entry 136176683         CDS       T10466                                  Symbol CASP3 Name (RefSeq) caspase-3 isoform X1   KO K02187   caspase 3 [EC:3.4.22.56] Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree01524   Platinum drug resistance mree04010   MAPK signaling pathway mree04115   p53 signaling pathway mree04148   Efferocytosis mree04210   Apoptosis mree04215   Apoptosis - multiple species mree04623   Cytosolic DNA-sensing pathway mree04650   Natural killer cell mediated cytotoxicity mree04657   IL-17 signaling pathway mree04668   TNF signaling pathway mree04726   Serotonergic synapse mree04932   Non-alcoholic fatty liver disease mree04933   AGE-RAGE signaling pathway in diabetic complications mree04936   Alcoholic liver disease mree05010   Alzheimer disease mree05012   Parkinson disease mree05014   Amyotrophic lateral sclerosis mree05016   Huntington disease mree05020   Prion disease mree05022   Pathways of neurodegeneration - multiple diseases mree05132   Salmonella infection mree05133   Pertussis mree05134   Legionellosis mree05145   Toxoplasmosis mree05146   Amoebiasis mree05152   Tuberculosis mree05160   Hepatitis C mree05161   Hepatitis B mree05162   Measles mree05163   Human cytomegalovirus infection mree05164   Influenza A mree05165   Human papillomavirus infection mree05167   Kaposi sarcoma-associated herpesvirus infection mree05168   Herpes simplex virus 1 infection mree05169   Epstein-Barr virus infection mree05170   Human immunodeficiency virus 1 infection mree05200   Pathways in cancer mree05203   Viral carcinogenesis mree05205   Proteoglycans in cancer mree05206   MicroRNAs in cancer mree05210   Colorectal cancer mree05222   Small cell lung cancer mree05416   Viral myocarditis mree05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136176683 (CASP3)    04668 TNF signaling pathway     136176683 (CASP3)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     136176683 (CASP3)   09143 Cell growth and death    04210 Apoptosis     136176683 (CASP3)    04215 Apoptosis - multiple species     136176683 (CASP3)    04115 p53 signaling pathway     136176683 (CASP3)  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     136176683 (CASP3)    04650 Natural killer cell mediated cytotoxicity     136176683 (CASP3)    04657 IL-17 signaling pathway     136176683 (CASP3)   09156 Nervous system    04726 Serotonergic synapse     136176683 (CASP3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136176683 (CASP3)    05206 MicroRNAs in cancer     136176683 (CASP3)    05205 Proteoglycans in cancer     136176683 (CASP3)    05203 Viral carcinogenesis     136176683 (CASP3)   09162 Cancer: specific types    05210 Colorectal cancer     136176683 (CASP3)    05222 Small cell lung cancer     136176683 (CASP3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     136176683 (CASP3)    05161 Hepatitis B     136176683 (CASP3)    05160 Hepatitis C     136176683 (CASP3)    05164 Influenza A     136176683 (CASP3)    05162 Measles     136176683 (CASP3)    05168 Herpes simplex virus 1 infection     136176683 (CASP3)    05163 Human cytomegalovirus infection     136176683 (CASP3)    05167 Kaposi sarcoma-associated herpesvirus infection     136176683 (CASP3)    05169 Epstein-Barr virus infection     136176683 (CASP3)    05165 Human papillomavirus infection     136176683 (CASP3)   09171 Infectious disease: bacterial    05132 Salmonella infection     136176683 (CASP3)    05133 Pertussis     136176683 (CASP3)    05134 Legionellosis     136176683 (CASP3)    05152 Tuberculosis     136176683 (CASP3)   09174 Infectious disease: parasitic    05146 Amoebiasis     136176683 (CASP3)    05145 Toxoplasmosis     136176683 (CASP3)   09164 Neurodegenerative disease    05010 Alzheimer disease     136176683 (CASP3)    05012 Parkinson disease     136176683 (CASP3)    05014 Amyotrophic lateral sclerosis     136176683 (CASP3)    05016 Huntington disease     136176683 (CASP3)    05020 Prion disease     136176683 (CASP3)    05022 Pathways of neurodegeneration - multiple diseases     136176683 (CASP3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136176683 (CASP3)    05416 Viral myocarditis     136176683 (CASP3)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     136176683 (CASP3)    04932 Non-alcoholic fatty liver disease     136176683 (CASP3)    04933 AGE-RAGE signaling pathway in diabetic complications     136176683 (CASP3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     136176683 (CASP3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mree01002]     136176683 (CASP3) Enzymes [BR:mree01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      136176683 (CASP3) Peptidases and inhibitors [BR:mree01002]  Cysteine peptidases   Family C14: caspase family    136176683 (CASP3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Peptidase_C14 Motif Other DBs NCBI-GeneID:  136176683 NCBI-ProteinID:  XP_065803243 LinkDB All DBs Position 10:complement(56804732..56826827) Genome browser AA seq 275 aa AA seqDB search MESTENSVDSKSIKASETKILHGSKSMDSGISLEERYKMDYPERGVCIIINNKNFHKNTG MECRSGTDVDAANIMETFMNLKYEVRIKNDLTCKEMLELMSNVSKEDHSRRSSFICVLLS HGEEGIIFGTNGPVSLKKLASFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGAED DMACQKIPVEADFLYAYSTAPGYFSWRNSKYGSWFIQALCEMLKKYARERELLHILTRVN RKVAIEYESFSTDSTFHAKKQIPCIVSMLTKDLYF NT seq 828 nt NT seq  +upstreamnt  +downstreamnt atggagagcactgaaaattcagtggattcaaaatccatcaaagcttcagagacaaagata ttacatggaagcaaatcaatggactctggaatatccttggaagagagatacaaaatggat tatcctgaaaggggtgtatgtataataattaataataagaacttccacaaaaatactggc atggaatgtcgatctggtacagacgtggatgcagcaaacatcatggaaaccttcatgaac ttgaaatatgaagtcaggattaaaaatgaccttacatgtaaagaaatgttggaattaatg agcaacgtttctaaagaagaccatagcagaaggagcagttttatttgcgtacttctaagc catggtgaagaaggaatcatttttggaacaaacggacccgtcagtctgaaaaaattagca agtttcttcagaggggactattgcagaagtctgactggaaagcccaaacttttcattatt caggcctgccgaggcacagagctagactgcggcatcgagacagacagtggtgctgaggat gacatggcctgccagaaaatcccggttgaggcagacttcttgtacgcatattctacagca cctggttacttttcctggcgaaactcaaagtatggatcctggttcatccaggctctttgt gagatgctgaaaaagtacgctcgcgagcgcgagctcctgcacattcttactcgggttaat cgaaaggtagcgatagaatatgagtccttctccaccgattctacttttcatgccaagaaa cagattccttgtattgtgtctatgctcacaaaagatctgtatttctaa

DBGET integrated database retrieval system