Nicotiana tabacum (common tobacco): 107759896 Help Entry 107759896         CDS       T04643                                  Name (RefSeq) RING-box protein 1a isoform X1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism nta  Nicotiana tabacum (common tobacco) Pathway nta03420   Nucleotide excision repair nta04120   Ubiquitin mediated proteolysis nta04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nta00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107759896    04120 Ubiquitin mediated proteolysis     107759896   09124 Replication and repair    03420 Nucleotide excision repair     107759896  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nta04121]     107759896    03400 DNA repair and recombination proteins [BR:nta03400]     107759896 Enzymes [BR:nta01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107759896 Ubiquitin system [BR:nta04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107759896   Multi subunit type E3    SCF complex     Ring finger protein      107759896    Cul2 complex      107759896    Cul3 complex      107759896    Cul4 complex      107759896    Cul7 complex      107759896    Cul8 complex      107759896    Cul9 complex      107759896 DNA repair and recombination proteins [BR:nta03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107759896     TCR (transcription coupled repair) factors      Cul4-CSA complex       107759896 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-RING_11 zf-RING_16 zf-RING-like zf-RING_5 Motif Other DBs NCBI-GeneID:  107759896 NCBI-ProteinID:  XP_016433387 UniProt:  A0A1S3X0G1 LinkDB All DBs Position 2:complement(125291703..125296251) Genome browser AA seq 134 aa AA seqDB search MASVDTDVTMVPAGEGSAGAGASSSSSTKKAKRFEIKKWNAVSLWAWDIVVDNCAICRNH IMDLCIECQANQASATSEECTVAWVPWTAFSVNFGILRGVCNHAFHFHCISRWLKTRQVC PLDNSEWEFQKYGH NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atggcatctgttgacaccgacgtgactatggttccggccggcgagggttccgccggtgcc ggagcttcatcatcatcttccactaagaaggccaagcgttttgagatcaaaaagtggaac gccgtctctctatgggcttgggatattgtggtagataactgtgctatctgtaggaaccac atcatggatctctgtattgaatgtcaagctaatcaagctagtgcaacaagtgaggaatgc acagtggcttgggtgccatggactgcattttctgtgaattttggaattttaaggggagtt tgcaaccatgcgttccacttccactgcattagtaggtggctcaagacacgtcaagtctgt cctcttgacaacagtgagtgggagtttcagaaatatggtcactag

DBGET integrated database retrieval system