Nicotiana tabacum (common tobacco): 107778193 Help Entry 107778193         CDS       T04643                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism nta  Nicotiana tabacum (common tobacco) Pathway nta00510   N-Glycan biosynthesis nta00513   Various types of N-glycan biosynthesis nta04141   Protein processing in endoplasmic reticulum Module nta_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:nta00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     107778193    00513 Various types of N-glycan biosynthesis     107778193  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107778193 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 ATP-synt_8 Motif Other DBs NCBI-GeneID:  107778193 NCBI-ProteinID:  XP_016453891 UniProt:  A0A1S3YNN8 LinkDB All DBs Position Un AA seq 78 aa AA seqDB search MVQSAKPISSPVPITWYPTLAVFMLAIGLIVTASFFIYEATSPRKYRSLVKELTTGAMAS VFLGFGSLFLLLASGVYV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggttcaatcagcaaaacccatttcaagcccagtacccattacatggtacccaacccta gcggtatttatgcttgcaattggccttatcgtaactgcttccttcttcatctatgaagct acttctccgaggaaatatcgcagtctcgtgaaggagcttacaactggagcaatggcatct gttttcttgggttttggatccttgtttttgctacttgcttcaggcgtatatgtttga

DBGET integrated database retrieval system