Nicotiana tabacum (common tobacco): 107784644 Help Entry 107784644         CDS       T04643                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism nta  Nicotiana tabacum (common tobacco) Pathway nta03420   Nucleotide excision repair nta04120   Ubiquitin mediated proteolysis nta04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nta00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107784644    04120 Ubiquitin mediated proteolysis     107784644   09124 Replication and repair    03420 Nucleotide excision repair     107784644  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nta04121]     107784644    03400 DNA repair and recombination proteins [BR:nta03400]     107784644 Enzymes [BR:nta01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107784644 Ubiquitin system [BR:nta04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107784644   Multi subunit type E3    SCF complex     Ring finger protein      107784644    Cul2 complex      107784644    Cul3 complex      107784644    Cul4 complex      107784644    Cul7 complex      107784644    Cul8 complex      107784644    Cul9 complex      107784644 DNA repair and recombination proteins [BR:nta03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107784644     TCR (transcription coupled repair) factors      Cul4-CSA complex       107784644 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  107784644 NCBI-ProteinID:  XP_016461287 UniProt:  A0A1S3ZAN3 LinkDB All DBs Position Un AA seq 120 aa AA seqDB search MASVDTDVTMVPAGDGSTGAGASSSSSTKKAKRFEIKKWNAVSLWAWDIVVDNCAICRNH IMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggcatctgtcgacaccgacgtgactatggttccggccggcgatggttctaccggtgcc ggagcttcatcatcatcttccactaagaaggccaagcgttttgagatcaaaaagtggaac gccgtctctctatgggcctgggatattgtggttgataactgtgctatctgtaggaaccac atcatggatctctgtattgaatgtcaagctaatcaagctagtgcaacaagtgaggaatgt acagtggcttggggagtttgcaaccatgcattccacttccattgcattagcaggtggctc aagactcgtcaagtctgtccacttgataacagcgagtgggagtttcagaaatatggtcac tag

DBGET integrated database retrieval system