KEGG   Oryctolagus cuniculus (rabbit): 100009535
Entry
100009535         CDS       T03373                                 
Symbol
PAK2, PAKI, Pak3
Name
(RefSeq) p21 (RAC1) activated kinase 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04660  T cell receptor signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu05170  Human immunodeficiency virus 1 infection
ocu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009535 (PAK2)
   04012 ErbB signaling pathway
    100009535 (PAK2)
   04014 Ras signaling pathway
    100009535 (PAK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100009535 (PAK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100009535 (PAK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100009535 (PAK2)
  09158 Development and regeneration
   04360 Axon guidance
    100009535 (PAK2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100009535 (PAK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100009535 (PAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100009535 (PAK2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100009535 (PAK2)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: STE group
  STE20 family
   100009535 (PAK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal ABC1 APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 100009535
NCBI-ProteinID: NP_001076225
Ensembl: ENSOCUG00000008224
UniProt: Q29502
LinkDB
Position
14:complement(91941353..92056318)
AA seq 524 aa
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGAPALNTKVSETSAVVTEEDDDDEEAAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSHVDSGAKSSDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccagcacctcctgtgcgaatgagcagc
accatctttagcactggaggcaaagaccccttgtcagccaatcacagcttgaagcctttg
ccctctgttccagaagaaaaaaagccaaggaataaaatcatctccatattctcaggcaca
gaaaaaggaagtaaaaagaaagaaaaagaacgaccagagatttctcctccctctgatttt
gagcacaccatccacgtcggcttcgatgctgttactggagaattcaccggcatgccggag
cagtgggcacgcctgctgcagacgtccaacatcaccaaactcgagcagaagaagaaccca
caggcagtgctggacgtgctcaagttctatgactccaacaccgtgaagcagaagtacctg
agcttcactcctccggagaaagatggcttcccttctggagcaccagcactgaataccaag
gtatcagaaacatcagcagtagtaacagaagaagatgacgatgacgaagaggcggcacct
cctgttattgccccacggccagatcatacaaaatcaatttatacacggtctgtaattgac
cctattcctgcaccagttggtgattctcatgttgatagtggtgccaagtcttcagataaa
cagaaaaagaaaaccaagatgacagatgaagagattatggagaaattacgaactattgtg
agcataggtgaccctaagaaaaaatatacaagatatgaaaaaattggacaaggggcttct
ggtacagttttcactgctactgatgtggcattgggacaggaggttgctatcaaacagatt
aatttacagaaacagccaaagaaggaattgatcattaatgaaattctggtgatgaaagag
ttaaaaaatcccaacatagttaacttcttggacagttacctagtgggagatgaattattc
gtggtaatggagtaccttgctggtggctcacttactgatgttgtaacagaaacctgcatg
gatgaagcgcagattgcagctgtgtgcagagagtgtttacaggctttggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtgcttttggggatggaagga
tcagttaaacttactgactttggtttctgtgcccagatcacccctgagcagagtaaacgc
agtaccatggttggaacgccttactggatggcacccgaggtggttacacggaaagcatat
ggccctaaagtcgacatatggtctctgggcatcatggctattgagatggtagaaggagaa
cctccatacctcaatgaaaatcccttgagggccttgtacctgatagcaactaatggaacc
ccagaacttcagaatccagagaagctttcccccatatttcgggatttcttaaatcgatgt
ttggaaatggatgtggagaagagaggttcagccaaagaactgctgcagcatcccttcctg
aaactggccaaaccattatccagcttgacaccactcatcatggcagctaaagaagcaatg
aagagtaaccgctaa

KEGG   Oryctolagus cuniculus (rabbit): 100340742
Entry
100340742         CDS       T03373                                 
Symbol
PAK5, PAK7
Name
(RefSeq) p21 (RAC1) activated kinase 5
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04660  T cell receptor signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu05170  Human immunodeficiency virus 1 infection
ocu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100340742 (PAK5)
   04014 Ras signaling pathway
    100340742 (PAK5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100340742 (PAK5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100340742 (PAK5)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100340742 (PAK5)
  09158 Development and regeneration
   04360 Axon guidance
    100340742 (PAK5)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100340742 (PAK5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100340742 (PAK5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100340742 (PAK5)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100340742 (PAK5)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: STE group
  STE20 family
   100340742 (PAK5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD ABC1 Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100340742
NCBI-ProteinID: XP_002711022
Ensembl: ENSOCUG00000010770
UniProt: G1SZY2
LinkDB
Position
4:26359498..26661590
AA seq 719 aa
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGQGHS
EENGFITFSQYSSESDTTVDYVTEKYREKSLYGDELDPYYKGSHVTKQNGHMMRMKHGEA
YYSEMKPVKGDIARFPVDYHAHLDSLSKPSDYGDLKWEYQRASSSSPLDYPFQFTPSRTA
GTSRCSKESLAYSESEWAPSLEDYDRRPKSSYMNQTSPQPAMRQRSRSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCFPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS
QSKGGYSSSSHQYPSGYQKASLYHHPSLQTSSQYISTASYLSSLSISSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagattgaaatatctggcccgtccaactttgagcacaga
gttcatactgggtttgatccacaagaacagaaatttaccggccttccacagcaatggcac
agcctgttagcagatactgccaacagaccgaagcccatggtggacccttcctgtatcacc
cccatacagctggcgcccatgaagacaatcgtcagaggaaacaaaccctgcaaggaaacc
tccatcaacggcctgctggaggatttcgacaatatctcggtgactcgctctaattcgcta
aggaaagaaagccctcctaccccggatcagggagcctctagccatggtcagggccattcg
gaagaaaacggcttcatcaccttctcacagtactccagcgaatccgataccactgtagac
tacgtgaccgaaaagtacagagaaaagagtctctacggagacgagttggatccgtactac
aaaggcagccatgtgaccaagcaaaacggacacatgatgaggatgaagcacggggaggcc
tactattccgagatgaaacctgtgaaaggtgatattgccagatttcctgtcgattatcac
gctcatttggactcgctgagcaaaccaagcgactatggtgatctcaagtgggagtaccag
cgagcctcaagcagctcccctctggattaccctttccagttcacgccttctagaactgcg
gggaccagcaggtgctccaaggagagtctggcctatagcgaaagtgagtgggcaccgagc
ctggaggactacgacaggaggccgaagtcgtcctacatgaaccagacgagtcctcagccg
gccatgcggcagaggtcccggtcaggttcagggctccaggaacccatgatgcccttcgga
gcaagtgcatttaaaacccatccccaaggacactcgtacaactcctacacctaccctcgc
ttgtcggagcccaccatgtgctttccaaaggtggactatgatcgagcacagatggtcctc
agcccaccactgtcagggtccgacacctaccccaggggccccgccaaactacctcaaagt
caaagcaaagggggctattcctccagcagccaccagtacccatctgggtaccaaaaagcc
tccctataccaccacccttccctgcagaccagctcgcagtacatctccaccgcctcttac
ctgagttctctcagcatctcatccagcacctaccctcctcccagctggggctcctcctca
gaccagcagccctccagggtgtcccacgaacagtttcgggctgccctgcagctggtggtc
agcccaggggaccccagggagtacctggacaactttatcaaaattggggaagggtcgacg
ggcattgtgtgcatcgccactgagaaacacacagggaaacaagttgcggtgaagaagatg
gacctccggaagcaacaaaggcgagagctgctttttaacgaggttgtgattatgcgggat
taccaccatgacaatgtggttgacatgtacaacagctaccttgttggtgatgagctctgg
gtggtcatggagttcctagaaggtggtgccttgacagacatcgttactcataccagaatg
aatgaagaacagatagctactgtctgcctgtcagttctgagagcactctcctaccttcac
aaccagggagtgattcacagggacataaagagtgactccatcctgttgaccagtgatggc
cggataaagttatctgactttggtttctgtgctcaagtgtccaaagaggtgccaaagagg
aaatcgctggttggcactccctattggatggcacctgaggtgatctccaggctaccttat
ggaacagaggtggacatctggtcccttgggatcatggtaatagaaatgattgatggtgag
cccccctacttcaatgagccacccctccaggcaatgcggaggatccgggacagtttacct
ccaagagtgaaggacctacacaaggtgtcttcagtgctccggggattcctagatctgatg
ttagtgagggagccctctcaaagagccacagcccaggaactccttggacatccattccta
aaactggcaggtccaccatcttgcatcgttcccctcatgagacaatacaggcatcactga

KEGG   Oryctolagus cuniculus (rabbit): 100341934
Entry
100341934         CDS       T03373                                 
Symbol
PAK4
Name
(RefSeq) p21 (RAC1) activated kinase 4
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04660  T cell receptor signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu05170  Human immunodeficiency virus 1 infection
ocu05206  MicroRNAs in cancer
ocu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100341934 (PAK4)
   04014 Ras signaling pathway
    100341934 (PAK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100341934 (PAK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100341934 (PAK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100341934 (PAK4)
  09158 Development and regeneration
   04360 Axon guidance
    100341934 (PAK4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100341934 (PAK4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100341934 (PAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100341934 (PAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100341934 (PAK4)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100341934 (PAK4)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: STE group
  STE20 family
   100341934 (PAK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD ABC1 Kinase-like Pkinase_fungal hnRNP_Q_AcD KIND Kdo
Other DBs
NCBI-GeneID: 100341934
NCBI-ProteinID: XP_002711515
Ensembl: ENSOCUG00000011285
LinkDB
Position
5:complement(725184..763478)
AA seq 594 aa
MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPLPARARQENGVPEE
RAAGARAGPEKAGGRGRATGRSEAGGASGDKRRVGPEKRPKSSREGSGGPQESSRDKRPL
SGPDVSTPQPAPLASGAKLAAGRPFNTYPRADTDHPSRGAQGEPRDVAPNGPSAGGRAVP
QSSSRPPARARGPPSPGVLGPHASEPQLAPPARTPAVPAVPAALPAPGPPGPRSPQREPQ
RVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQ
QRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQI
AAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVG
TPYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKN
LHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLSKAGPPASIVPLMRQNRAR
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgttcgggaagaggaagaagcgggtggagatctcggcgccgtccaacttcgagcaccgc
gtgcacaccggcttcgaccagcacgagcagaagttcacggggctgccgcgccagtggcag
agcctcatcgaggagtcggctcgcaggcccaagcccctcgtcgaccccgcctgcatcacc
tccatccagccaggggcccccaagaccatcgtgcggggcagcaaaggtgccaaggatggg
gccctcacgctgctgctcgacgagtttgagaacatgtcggtgacgcgctccaactccctg
cggagagacagcccgccgctgcccgcccgcgcccgccaggagaacggggtgccggaggag
agggccgcaggcgccagagcaggcccggagaaggcgggcggccgaggccgggccaccggc
cgcagcgaggcaggaggcgccagcggtgacaagcgacgggtggggcctgagaagaggccc
aagtcttccagggagggctcagggggcccccaggagtcctcccgggacaaacgccccctc
tctgggcctgacgtcagcacccctcagcctgcccctctggccagcggagcaaagctggcg
gctggccggccctttaacacgtacccccgggccgacacggaccacccatcccggggtgcc
cagggagagcctcgcgatgtggccccgaatgggccctccgcagggggccgggccgtcccg
cagtcctcttcccggcctcccgcccgagcccgcggccccccgagtcctggagtgctgggt
ccccacgcctctgagccccagctggccccgccagcccgcacccccgctgtccccgctgtc
cccgctgccctccctgccccggggccccccggcccccgctccccacagcgggagccgcag
cgagtgtcccacgagcagttcagggctgccctgcagctggtggtggacccaggggacccg
cgctcctacctggacaacttcatcaagattggcgagggctccacgggcatcgtgtgcatc
gccaccgtgcgcagctcgggcaagctggtggctgtgaagaagatggacctgcgcaagcag
cagaggcgcgagctgctcttcaacgaggtggtaatcatgcgggactaccagcacgagaac
gtggtggagatgtacaacagctacctggtgggcgacgagctctgggtggtgatggagttt
ctggagggaggtgccctcaccgacatcgtcacccacaccaggatgaacgaggagcagata
gccgccgtgtgcctggccgtgctgcaggccctgtccgtgctccatgcccagggcgtcatc
caccgggacatcaagagtgactcaatcctgctcacccacgatggcagggtgaagctgtcg
gacttcgggttctgcgcccaggtgagcaaggaggtgccgcggaggaagtcactggtcggc
accccctactggatggccccggagctcatctcccgcctgccctatgggccggaggtggac
atctggtcgctgggcgtcatggtgatcgagatggtggacggggagcccccctacttcaac
gagccacccctcaaagccatgaagatgattcgggacaacctgccgccccggctgaagaac
ctgcacaaggtgtcgccatccctgaagggcttcctggaccggctgctggtgcgcgacccc
gcacagcgggccacggcggccgagctgctgaagcacccgttcctgagcaaggcggggccg
cccgccagcatcgtgcccctcatgcgccagaaccgcgccagatga

KEGG   Oryctolagus cuniculus (rabbit): 100347273
Entry
100347273         CDS       T03373                                 
Symbol
PAK3
Name
(RefSeq) p21 (RAC1) activated kinase 3
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04660  T cell receptor signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu05132  Salmonella infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100347273 (PAK3)
   04014 Ras signaling pathway
    100347273 (PAK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100347273 (PAK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100347273 (PAK3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100347273 (PAK3)
  09158 Development and regeneration
   04360 Axon guidance
    100347273 (PAK3)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100347273 (PAK3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100347273 (PAK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100347273 (PAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100347273 (PAK3)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100347273 (PAK3)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: STE group
  STE20 family
   100347273 (PAK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD ABC1 Pkinase_fungal Kinase-like Spt5_N DSHCT APH Ribosomal_60s Kdo
Other DBs
NCBI-GeneID: 100347273
NCBI-ProteinID: XP_002720245
Ensembl: ENSOCUG00000007033
UniProt: G1TUX8
LinkDB
Position
X:59340434..59619920
AA seq 559 aa
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTS
NITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPP
LAPPVSEEEDEEEEEEEDDNEPPPVIAPRPEHTKSIYTRSVVESIASPAAPNKEVTPPSA
ENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTA
LDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYL
AGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTD
FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNE
NPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPL
SSLTPLIIAAKEAIKNSSR
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgtctgacggtttggataatgaagagaaacccccagctcccccactgaggatgaatagc
aacaaccgggattcttcagcactcaaccacagctccaagccgcttcccatggcccctgaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaggagaaagagcgcccagagatctctcttccttcagactttgagcatacgatt
catgtggggtttgatgcagtcaccggggaattcactccagatctctatggctcacagatg
tgcccagggaagctcccagagggaattcctgagcaatgggcacgattactccaaacttcc
aacataacaaaactggaacagaagaagaacccacaagctgttctagatgttctcaagttc
tatgattccaaagaaacagtcaataaccagaaatacatgagctttacatcaggagataaa
agtgcccatggatacatagcagcccatccttcgagtacaaaaacagcttcagagcctcct
ttggctcctcctgtgtctgaagaagaagatgaagaggaggaagaagaagaagacgacaat
gagcctccacccgttattgcaccaagaccagagcatacaaaatcaatctatactcgttct
gtggttgaatccattgcttcaccggcagcaccaaacaaagaggtcacaccaccttccgct
gagaatgccaattccagcactttgtacaggaacacagatcggcaaaggaaaaaatccaag
atgactgatgaggagatcctagagaagctaagaagcattgtgagtgttggagatccaaag
aaaaaatacacaagatttgaaaaaattggtcaaggggcatcagggactgtttacacagca
ctggacattgcaacagggcaagaagtggccataaagcagatgaatctacaacagcaaccc
aaaaaggaattaattattaatgaaattctggtcatgagggaaaataagaaccccaatatt
gttaattatttagatagctacttagtaggtgatgaactatgggtagtgatggaatacctg
gctggtggctctttgactgatgtggtcacagagacctgtatggatgaaggacagatagca
gctgtctgcagagagtgcctccaagctttggatttcttacactcaaaccaagtgatccat
agagacataaagagtgacaatatcctcctcgggatggatggctctgttaaactgactgat
tttgggttctgtgcccagatcactcctgagcaaagtaaacggagcactatggtgggaacc
ccctattggatggcacctgaggtggtaactcgaaaagcatatggtccgaaagttgatatc
tggtctctgggaattatggcaattgaaatggtggaaggtgaacccccttaccttaatgaa
aatccactcagggcattatatctgatagccactaatggaaccccggagctccagaatcct
gagagactgtcagctgtattccgtgactttttaaatcgctgtcttgagatggatgtggat
aggcgaggatctgccaaggagcttttgcagcatccatttttaaaattagccaagcctctc
tccagcctgactcctctgattatcgctgcaaaggaagcgattaagaacagcagccgctag

KEGG   Oryctolagus cuniculus (rabbit): 100348921
Entry
100348921         CDS       T03373                                 
Symbol
PAK6
Name
(RefSeq) p21 (RAC1) activated kinase 6
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04660  T cell receptor signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu05170  Human immunodeficiency virus 1 infection
ocu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100348921 (PAK6)
   04014 Ras signaling pathway
    100348921 (PAK6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100348921 (PAK6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100348921 (PAK6)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100348921 (PAK6)
  09158 Development and regeneration
   04360 Axon guidance
    100348921 (PAK6)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100348921 (PAK6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100348921 (PAK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100348921 (PAK6)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100348921 (PAK6)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: STE group
  STE20 family
   100348921 (PAK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like ABC1 Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 100348921
NCBI-ProteinID: XP_017203636
Ensembl: ENSOCUG00000026281
UniProt: G1U2J1
LinkDB
Position
17:complement(31736148..31745598)
AA seq 681 aa
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSSVPSDGYISGLLNDIQKLSVTSSNTLRGRSPTSRRRAQSLGLLGDE
HWAADPDMYLQSPQSERTEPHGLYLSCNGGTPAGPRQGPGPEPQSPRVLPNGLAAKAQSL
GPAEFHGASQRCLQLGACLQSSPPGTSSPAAAGRRGTKAAKHGSEEARPQSCLVGSAAGR
PGGEGSPSPKAQESSLKRRLFRSMFLSTPASAAPGSSKPGPLPQSKPSSSFRQPQKDSLP
SLVVKAQSLPSDQPVGTFSPLPPSDTSSPLKSLRTNPATGPLPSRSSPAGSPRTRHAQIS
TSNLYLPQDPAAAKGALAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGI
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHLNVVEMYKSYLVGEELWVL
MEFLQGGALTDIISQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRV
KLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDVWSLGIMVIEMVDGEPP
YFSDSPVQAMKRLRDSPPPRLRNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQ
TGLPECLVPLIQLYRKQTSAC
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgttccgcaagaagaagaagaaacgccccgagatctccgccccgcagaacttccagcac
cgcgtccacacctcctttgaccctaaggagggcaagtttgtggggctccccccacagtgg
cagaacatcctggacactctgcggcgccccaagcctgtggtggacccttcacgcatcaca
cgggtgcagctgcagcccatgaagactgtggtgcggggcagttcagtgccctccgacggc
tacatctcagggctgctcaatgacatccagaagttgtcggtcaccagctccaacaccctg
cgcggccgcagccccaccagccggcggcgggcccagtccctggggctgctgggggacgag
cactgggccgctgacccggacatgtacctccagagcccacagtcggagcgcaccgagccc
cacggcctctacctcagctgcaacgggggcacaccagcaggccccaggcaggggccgggg
cccgagccgcagagtccgcgcgtcctgcctaacgggctggccgccaaggcgcagtccctg
ggccccgccgagttccacggtgcctcgcagcgctgcctgcagctcggtgcctgcttgcag
agctccccgcccggcacgtcttctcccgcggcagctggcaggcgtggcacaaaggctgcc
aagcacggctccgaggaggcccggccacagtcctgcctggtaggctcggccgcaggcagg
cccggaggggaaggcagcccgagccccaaggcccaggagagcagcctgaagcgcaggctg
ttccgaagcatgttcctgtccactcccgcctcagccgctccgggcagcagcaagccaggc
cctctaccgcagagcaagcccagctcctccttccgccagccgcagaaagactccctgcca
agcctggtggtcaaggcccagtccttgccttcagaccagcctgtggggacattcagtcct
ctgcccccttcggacaccagcagccccctgaagtccctccgtaccaacccggccaccggc
ccactgcccagccggtcctcaccggccggctcccccaggacccggcacgctcagatcagc
accagcaacctgtacctgccccaggaccccgcagcggccaagggcgccctggccggcgag
gacacgggtgtggtgactcacgagcagttcaaggccgcgctcaggatggtggtggaccag
ggtgacccccggctgctgctggacagctacgtgaagatcggcgagggctccactggcatc
gtctgcctggcccgtgagaagcactcgggccgtcaggtggccgtcaagatgatggacctc
cggaagcagcagcgccgggagctgctctttaatgaggtggtgatcatgcgagactaccag
cacctgaacgtggtagagatgtacaagagctacctggtgggcgaggagctgtgggtgctc
atggagttcctgcagggtggggccctcaccgacatcatctcccaagtcaggctgaacgag
gagcagatcgccaccgtgtgcgaggccgtgctgcaggcactggcttacctgcacgcccag
ggagtcatccaccgggacatcaagagcgactccatcctgctgaccctggacggcagggtg
aagctctccgacttcggattctgtgctcagatcagcaaagatgtccctaagaggaagtcc
ctggtgggaaccccctactggatggctccagaagtgatctccaggtctctgtatgccacc
gaggtggatgtctggtccctgggcatcatggtgatcgagatggtggatggggagccaccc
tacttcagcgactcgccggtgcaagccatgaagaggctccgggacagccccccgcccagg
ctgaggaattcccacaaggtctccccggtgcttcgagacttcctggagcggatgctggtg
cgggacccccaagagagggccacagcccaggagctcctggaccaccccttcctgctgcag
acggggctgcccgagtgcctggtgcccctgatccagctctaccgcaagcagacctccgcc
tgctga

KEGG   Oryctolagus cuniculus (rabbit): 100352056
Entry
100352056         CDS       T03373                                 
Symbol
PAK1
Name
(RefSeq) p21 (RAC1) activated kinase 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04360  Axon guidance
ocu04392  Hippo signaling pathway - multiple species
ocu04510  Focal adhesion
ocu04625  C-type lectin receptor signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04660  T cell receptor signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05132  Salmonella infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05205  Proteoglycans in cancer
ocu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100352056 (PAK1)
   04012 ErbB signaling pathway
    100352056 (PAK1)
   04014 Ras signaling pathway
    100352056 (PAK1)
   04392 Hippo signaling pathway - multiple species
    100352056 (PAK1)
   04024 cAMP signaling pathway
    100352056 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100352056 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100352056 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100352056 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    100352056 (PAK1)
   04660 T cell receptor signaling pathway
    100352056 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    100352056 (PAK1)
   04062 Chemokine signaling pathway
    100352056 (PAK1)
  09158 Development and regeneration
   04360 Axon guidance
    100352056 (PAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100352056 (PAK1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100352056 (PAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100352056 (PAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100352056 (PAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100352056 (PAK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100352056 (PAK1)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100352056 (PAK1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100352056 (PAK1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: STE group
  STE20 family
   100352056 (PAK1)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100352056 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    100352056 (PAK1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100352056 (PAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD ABC1 Kinase-like Pkinase_fungal DSHCT APH Kdo
Other DBs
NCBI-GeneID: 100352056
NCBI-ProteinID: XP_017199968
Ensembl: ENSOCUG00000010538
UniProt: G1TLL9
LinkDB
Position
1:139220747..139414205
AA seq 544 aa
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSTEDYNSSNTLNVKTVSETPAVPPVSEDEDDE
DDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEK
QKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQM
NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCM
DEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKR
STMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGT
PELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
KNNH
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcctagacattcaagacaaacccccggcccctccgatgagaaacacc
agcactatgattggagcaggcagcaaagatgctggaaccctgaaccatggttccaaacct
ctacccccaaacccagaggagaagaagaagaaggaccgcttttaccgatccatcttacct
ggagataaaacaaataaaaagaaggaaaaggagcggccagaaatttctcttccttcagat
tttgagcacacaattcacgttggttttgatgctgtcacaggggagtttacgggaatgcca
gagcagtgggcccgcttgcttcagacatcaaatattactaagtcggaacagaagaaaaac
ccgcaggctgttctggatgtgttagaattttacaactcaaagaagacctccaacagccag
aagtacatgagctttacagataaatctactgaggattataattcttctaacactttgaat
gtgaagactgtgtctgagactcctgcagtgccaccagtttcagaagatgaagatgatgaa
gatgatgctactccacctccagtgattgctccacgtccagagcacacaaaatctgtatac
acacgttctgtgattgaaccactgcctgttaccccaactcgggatgtggctacatctccc
atttcacctactgagaataataccactccaccggatgctttgacccggaatactgaaaag
cagaagaagaagcctaaaatgtctgatgaggagatcttggagaaattacgaagcatagtg
agtgtgggcgatcctaagaagaaatatactcggtttgagaagattggacaaggtgcttca
ggcaccgtatacactgcaatggatgtagccacaggacaggaggtggccattaagcagatg
aacctgcagcagcagccaaagaaagagctgattattaatgagatcctggtcatgagggaa
aacaagaacccaaatattgtgaactacttggacagttatcttgtgggggatgagctgtgg
gtcgtcatggaatacttggctggaggctccttgacagatgtggtgacagaaacctgtatg
gatgaaggccagattgcagctgtgtgccgtgagtgtttgcaggctctggagtttctgcat
tcgaaccaggtcatacacagagacatcaagagtgacaatattctattgggaatggatggc
tctgtcaagctaactgattttggattctgtgcacaaataactccagagcagagcaaacgg
agcaccatggtgggaaccccatactggatggcaccggaggttgtgacacggaaggcctat
gggcccaaggttgacatctggtccctgggcatcatggcgattgaaatgattgaaggggag
cctccatacctcaatgaaaaccctctaagagccttgtacctcattgccaccaatggaacc
ccagagcttcagaacccagagaagctgtcggctattttccgggactttctgaaccgctgt
ctcgagatggatgtggagaagagaggttcagcaaaagagctgctacagcatcaattcctg
aagattgccaagcccctctccagcctcactccactgatcgctgcagcaaaggaggcaacc
aagaacaatcactaa

DBGET integrated database retrieval system