Ochotona princeps (American pika): 101517552 Help Entry 101517552         CDS       T07609                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism opi  Ochotona princeps (American pika) Pathway opi00510   N-Glycan biosynthesis opi00513   Various types of N-glycan biosynthesis opi04141   Protein processing in endoplasmic reticulum Module opi_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:opi00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     101517552    00513 Various types of N-glycan biosynthesis     101517552  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101517552 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF7027 Motif Other DBs NCBI-GeneID:  101517552 NCBI-ProteinID:  XP_036350563 LinkDB All DBs Position 13:87031416..87031807 Genome browser AA seq 79 aa AA seqDB search MELEVRSRYTSLVNPAVFPDLTVVLLAIGMFFTAWFFVHEVTSTKHTKYTYKELLISLVA SLFMGFGILFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggtcaggagcagatacaccagcctggtgaacccagccgtcttccccgac ttgactgtggtgctgttggccatcggcatgttcttcactgcctggttcttcgtccacgaa gtcacctccaccaagcacaccaagtacacctacaaagagctcctcatctccttggtggcc tcactcttcatgggctttgggatcctcttcctcctgctctgggtcggcatctatgtgtga

DBGET integrated database retrieval system