Ochotona princeps (American pika): 101517557 Help Entry 101517557         CDS       T07609                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism opi  Ochotona princeps (American pika) Pathway opi03050   Proteasome opi04060   Cytokine-cytokine receptor interaction opi04066   HIF-1 signaling pathway opi04217   Necroptosis opi04350   TGF-beta signaling pathway opi04380   Osteoclast differentiation opi04612   Antigen processing and presentation opi04630   JAK-STAT signaling pathway opi04650   Natural killer cell mediated cytotoxicity opi04657   IL-17 signaling pathway opi04658   Th1 and Th2 cell differentiation opi04659   Th17 cell differentiation opi04660   T cell receptor signaling pathway opi04940   Type I diabetes mellitus opi05140   Leishmaniasis opi05142   Chagas disease opi05143   African trypanosomiasis opi05144   Malaria opi05145   Toxoplasmosis opi05146   Amoebiasis opi05152   Tuberculosis opi05160   Hepatitis C opi05164   Influenza A opi05168   Herpes simplex virus 1 infection opi05200   Pathways in cancer opi05235   PD-L1 expression and PD-1 checkpoint pathway in cancer opi05321   Inflammatory bowel disease opi05322   Systemic lupus erythematosus opi05323   Rheumatoid arthritis opi05330   Allograft rejection opi05332   Graft-versus-host disease opi05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     101517557 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     101517557 (IFNG)    04630 JAK-STAT signaling pathway     101517557 (IFNG)    04066 HIF-1 signaling pathway     101517557 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101517557 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101517557 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     101517557 (IFNG)    04612 Antigen processing and presentation     101517557 (IFNG)    04660 T cell receptor signaling pathway     101517557 (IFNG)    04658 Th1 and Th2 cell differentiation     101517557 (IFNG)    04659 Th17 cell differentiation     101517557 (IFNG)    04657 IL-17 signaling pathway     101517557 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     101517557 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101517557 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101517557 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     101517557 (IFNG)    05164 Influenza A     101517557 (IFNG)    05168 Herpes simplex virus 1 infection     101517557 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     101517557 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     101517557 (IFNG)    05144 Malaria     101517557 (IFNG)    05145 Toxoplasmosis     101517557 (IFNG)    05140 Leishmaniasis     101517557 (IFNG)    05142 Chagas disease     101517557 (IFNG)    05143 African trypanosomiasis     101517557 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     101517557 (IFNG)    05323 Rheumatoid arthritis     101517557 (IFNG)    05321 Inflammatory bowel disease     101517557 (IFNG)    05330 Allograft rejection     101517557 (IFNG)    05332 Graft-versus-host disease     101517557 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101517557 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101517557 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:opi03051]     101517557 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:opi04052]     101517557 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:opi00536]     101517557 (IFNG) Proteasome [BR:opi03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     101517557 (IFNG) Cytokines and neuropeptides [BR:opi04052]  Cytokines   Interferons    101517557 (IFNG) Glycosaminoglycan binding proteins [BR:opi00536]  Heparan sulfate / Heparin   Cytokines    101517557 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma Motif Other DBs NCBI-GeneID:  101517557 NCBI-ProteinID:  XP_004583065 LinkDB All DBs Position 4:complement(26132924..26136932) Genome browser AA seq 168 aa AA seqDB search MNYTSCFLAFQLCIILGSSGCYCQEILSKEAHQIKEYFKANTSDVATGGPLFLNILRNWK EESDLKIIQSQLVSFYFKLFDNLKDHEVIRESVESIKEDIFVKFFNSSLTKLQDFQNLTQ ISVDDQQVQRKAISELSNVVNFLFSKPNTKKRKRSQSGVFRGRRASKY NT seq 507 nt NT seq  +upstreamnt  +downstreamnt atgaattacacaagttgcttcttggcttttcaactctgcatcattttgggttcttcaggc tgttactgtcaggagatactttccaaagaagcacatcagataaaggaatattttaaagca aatacttcagatgtggcaactggtggaccacttttcttgaatattctgagaaattggaaa gaggagagtgacctcaaaataattcagagccaacttgtctccttctacttcaaactcttt gacaacttgaaagaccacgaggtcatcagagagagcgtggaatccatcaaggaagacatt tttgtgaagttcttcaatagcagcctcactaagctgcaagacttccaaaatctgactcaa atttcggtagatgaccaacaggtccagcgcaaggcaataagtgaactctccaatgttgtg aattttctgttttcaaaacctaacaccaaaaagcgaaaaaggagtcaaagtggagtgttt cgaggccggcgagcatccaaatactga

DBGET integrated database retrieval system