Ochotona princeps (American pika): 101518086 Help Entry 101518086         CDS       T07609                                  Symbol ACTG1 Name (RefSeq) actin, cytoplasmic 2   KO K05692   actin beta/gamma 1 Organism opi  Ochotona princeps (American pika) Pathway opi03082   ATP-dependent chromatin remodeling opi04015   Rap1 signaling pathway opi04145   Phagosome opi04210   Apoptosis opi04390   Hippo signaling pathway opi04510   Focal adhesion opi04520   Adherens junction opi04530   Tight junction opi04611   Platelet activation opi04613   Neutrophil extracellular trap formation opi04670   Leukocyte transendothelial migration opi04714   Thermogenesis opi04810   Regulation of actin cytoskeleton opi04814   Motor proteins opi04820   Cytoskeleton in muscle cells opi04919   Thyroid hormone signaling pathway opi04921   Oxytocin signaling pathway opi04971   Gastric acid secretion opi05014   Amyotrophic lateral sclerosis opi05100   Bacterial invasion of epithelial cells opi05132   Salmonella infection opi05135   Yersinia infection opi05164   Influenza A opi05205   Proteoglycans in cancer opi05225   Hepatocellular carcinoma opi05410   Hypertrophic cardiomyopathy opi05412   Arrhythmogenic right ventricular cardiomyopathy opi05414   Dilated cardiomyopathy opi05416   Viral myocarditis opi05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101518086 (ACTG1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101518086 (ACTG1)    04390 Hippo signaling pathway     101518086 (ACTG1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     101518086 (ACTG1)   09143 Cell growth and death    04210 Apoptosis     101518086 (ACTG1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101518086 (ACTG1)    04520 Adherens junction     101518086 (ACTG1)    04530 Tight junction     101518086 (ACTG1)   09142 Cell motility    04814 Motor proteins     101518086 (ACTG1)    04820 Cytoskeleton in muscle cells     101518086 (ACTG1)    04810 Regulation of actin cytoskeleton     101518086 (ACTG1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101518086 (ACTG1)    04613 Neutrophil extracellular trap formation     101518086 (ACTG1)    04670 Leukocyte transendothelial migration     101518086 (ACTG1)   09152 Endocrine system    04921 Oxytocin signaling pathway     101518086 (ACTG1)    04919 Thyroid hormone signaling pathway     101518086 (ACTG1)   09154 Digestive system    04971 Gastric acid secretion     101518086 (ACTG1)   09159 Environmental adaptation    04714 Thermogenesis     101518086 (ACTG1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101518086 (ACTG1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     101518086 (ACTG1)   09172 Infectious disease: viral    05164 Influenza A     101518086 (ACTG1)   09171 Infectious disease: bacterial    05132 Salmonella infection     101518086 (ACTG1)    05135 Yersinia infection     101518086 (ACTG1)    05100 Bacterial invasion of epithelial cells     101518086 (ACTG1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101518086 (ACTG1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101518086 (ACTG1)    05410 Hypertrophic cardiomyopathy     101518086 (ACTG1)    05412 Arrhythmogenic right ventricular cardiomyopathy     101518086 (ACTG1)    05414 Dilated cardiomyopathy     101518086 (ACTG1)    05416 Viral myocarditis     101518086 (ACTG1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:opi03021]     101518086 (ACTG1)    03019 Messenger RNA biogenesis [BR:opi03019]     101518086 (ACTG1)    03036 Chromosome and associated proteins [BR:opi03036]     101518086 (ACTG1)    03029 Mitochondrial biogenesis [BR:opi03029]     101518086 (ACTG1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:opi04812]     101518086 (ACTG1)    04147 Exosome [BR:opi04147]     101518086 (ACTG1) Transcription machinery [BR:opi03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      101518086 (ACTG1) Messenger RNA biogenesis [BR:opi03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      101518086 (ACTG1) Chromosome and associated proteins [BR:opi03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      101518086 (ACTG1)     NuA4 complex      101518086 (ACTG1)   Chromatin remodeling factors    BAF complex     101518086 (ACTG1)    PBAF complex     101518086 (ACTG1)    GBAF(ncBAF) complex     101518086 (ACTG1)    SWR1 complex     101518086 (ACTG1) Mitochondrial biogenesis [BR:opi03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     101518086 (ACTG1) Cytoskeleton proteins [BR:opi04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      101518086 (ACTG1) Exosome [BR:opi04147]  Exosomal proteins   Proteins found in most exosomes    101518086 (ACTG1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  101518086 NCBI-ProteinID:  XP_004592907 LinkDB All DBs Position Unknown AA seq 336 aa AA seqDB search MKGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGV THTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYV ALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTF NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV WIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt atgaagggcgtcatggtgggcatgggccagaaggactcgtacgtgggcgacgaggcgcag agcaagcgcggcatcctgaccctcaagtaccccatcgagcacggcatcgtgaccaactgg gacgacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggcccccgag gagcaccccgtgctgctgaccgaggcccctctgaaccccaaggccaaccgcgagaagatg acccagatcatgttcgagaccttcaacacgccggccatgtacgtggccatccaggccgtg ctgtcgctgtacgcctccggccgcaccacgggcatcgtgatggactccggcgacggcgtc acccacacggtgcccatctatgagggctacgcccttccccacgccatcctgcgtctggac ctggccggccgggacctgaccgactacctcatgaagatcctcacggagcgcggctacagc ttcaccaccacggccgagcgtgagatcgtgcgtgacatcaaggagaagctgtgctacgtc gccctggacttcgagcaggagatggccacggctgcgtcctcctcctcactggagaagagc tacgagctgcccgacggccaggtcatcaccatcggcaacgagcgcttccgctgccccgag gcgctcttccagccctcattcttgggcatggagtcctgtggcatccacgagacgaccttc aactccatcatgaagtgcgacgtggacatccgtaaggacctgtacgccaacaccgtgctc tccggcggtaccaccatgtacccgggcatcgctgaccgcatgcagaaggagatcaccgcc ctggcgcccagcaccatgaagatcaagatcatcgctccccctgagcgcaagtactcggtg tggatcggcggctcgatcctggcctcgctgtccaccttccagcagatgtggatcagcaag caggagtacgacgagtccggcccctccatcgtgcaccgcaagtgcttctag

DBGET integrated database retrieval system