Ochotona princeps (American pika): 101524093 Help Entry 101524093         CDS       T07609                                  Symbol IL4 Name (RefSeq) interleukin-4 isoform X1   KO K05430   interleukin 4 Organism opi  Ochotona princeps (American pika) Pathway opi04060   Cytokine-cytokine receptor interaction opi04151   PI3K-Akt signaling pathway opi04630   JAK-STAT signaling pathway opi04640   Hematopoietic cell lineage opi04657   IL-17 signaling pathway opi04658   Th1 and Th2 cell differentiation opi04659   Th17 cell differentiation opi04660   T cell receptor signaling pathway opi04664   Fc epsilon RI signaling pathway opi04672   Intestinal immune network for IgA production opi05140   Leishmaniasis opi05200   Pathways in cancer opi05310   Asthma opi05320   Autoimmune thyroid disease opi05321   Inflammatory bowel disease opi05330   Allograft rejection Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101524093 (IL4)    04151 PI3K-Akt signaling pathway     101524093 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101524093 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101524093 (IL4)    04660 T cell receptor signaling pathway     101524093 (IL4)    04658 Th1 and Th2 cell differentiation     101524093 (IL4)    04659 Th17 cell differentiation     101524093 (IL4)    04657 IL-17 signaling pathway     101524093 (IL4)    04664 Fc epsilon RI signaling pathway     101524093 (IL4)    04672 Intestinal immune network for IgA production     101524093 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101524093 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101524093 (IL4)   09163 Immune disease    05310 Asthma     101524093 (IL4)    05320 Autoimmune thyroid disease     101524093 (IL4)    05321 Inflammatory bowel disease     101524093 (IL4)    05330 Allograft rejection     101524093 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:opi04052]     101524093 (IL4)    00536 Glycosaminoglycan binding proteins [BR:opi00536]     101524093 (IL4) Cytokines and neuropeptides [BR:opi04052]  Cytokines   Interleukins    101524093 (IL4) Glycosaminoglycan binding proteins [BR:opi00536]  Heparan sulfate / Heparin   Cytokines    101524093 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  101524093 NCBI-ProteinID:  XP_004586451 LinkDB All DBs Position 3A:complement(38035056..38042466) Genome browser AA seq 147 aa AA seqDB search MGLPSHLPVTLLCLLAGTGHFVHSHRGDIILPEVIKTLNLLTERKSPCTKLTIADVLAVP KNTTEKEALCRAATALRQFYRQQRALQCVTQHGEQHVLRYLKGLDRNLCSMARMNNCPSK GATQTTLEDFLDRLKTTMQKKYSKHQS NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggggctcccctcccacctgcctgtcactctcctctgcctcctggcaggcaccggtcac ttcgtccacagccacaggggcgacatcatcttaccagaggtcatcaaaaccctgaacctc ctcacagagaggaagtcaccatgcaccaagctgaccatcgctgacgtcctggctgtcccc aagaacacgactgagaaggaagcactctgcagggctgcaactgcactccggcagttctac cgtcaacagcgtgcgctccagtgtgtcacccagcatggagagcaacatgttctcagatac ctgaagggactcgacaggaacctctgcagcatggcaagaatgaacaactgcccttccaag ggagccacgcagactacactggaagacttcctggacaggctaaagacgacaatgcaaaag aaatactcaaagcatcaaagctaa

DBGET integrated database retrieval system