Ochotona princeps (American pika): 101525062 Help Entry 101525062         CDS       T07609                                  Symbol RAN Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism opi  Ochotona princeps (American pika) Pathway opi03008   Ribosome biogenesis in eukaryotes opi03013   Nucleocytoplasmic transport opi03250   Viral life cycle - HIV-1 opi05166   Human T-cell leukemia virus 1 infection Brite KEGG Orthology (KO) [BR:opi00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     101525062 (RAN)    03008 Ribosome biogenesis in eukaryotes     101525062 (RAN)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     101525062 (RAN)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101525062 (RAN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:opi03019]     101525062 (RAN)    03009 Ribosome biogenesis [BR:opi03009]     101525062 (RAN)    03016 Transfer RNA biogenesis [BR:opi03016]     101525062 (RAN)    03036 Chromosome and associated proteins [BR:opi03036]     101525062 (RAN)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:opi04147]     101525062 (RAN)    04031 GTP-binding proteins [BR:opi04031]     101525062 (RAN) Messenger RNA biogenesis [BR:opi03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      101525062 (RAN) Ribosome biogenesis [BR:opi03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     101525062 (RAN)   Pre-60S particles     101525062 (RAN) Transfer RNA biogenesis [BR:opi03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     101525062 (RAN) Chromosome and associated proteins [BR:opi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      101525062 (RAN)    Spindle formation proteins     101525062 (RAN) Exosome [BR:opi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101525062 (RAN) GTP-binding proteins [BR:opi04031]  Small (monomeric) G-proteins   Ran Family    Ran     101525062 (RAN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU AAA_22 RNA_helicase Gtr1_RagA AAA_16 ArgoMid TsaE AAA_7 AAA_24 AAA_33 SRPRB DUF5935 DUF5906 VapE-like_dom Motif Other DBs NCBI-GeneID:  101525062 NCBI-ProteinID:  XP_036352354 LinkDB All DBs Position 21:4118418..4121827 Genome browser AA seq 215 aa AA seqDB search MHSNWGQHQGVLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKF NVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCG NKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPA LAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgcactcgaactggggccagcaccaaggcgtgctggtgctggtcggcgacggcggcacc gggaagacgaccttcgtgaagcgccacctgaccggcgagttcgagaagaagtatgtagcc acgctgggcgtcgaggtgcacccgctcgtgttccacaccaaccgggggcccatcaagttc aacgtgtgggacacagccggccaggagaagttcggcggcctgcgggacggctactatatc caagcccagtgtgccatcatcatgtttgacgtgacgtccagagtgacctacaagaacgtg cccaactggcacagagacctggtgcgcgtgtgtgagaacatccccattgtgctgtgtggc aacaaggtggatatcaaggacaggaaagtgaaggcaaaatccattgtcttccaccgaaag aagaatctccagtactatgacatttctgccaaaagtaactacaactttgagaagcccttc ctctggcttgctaggaagctcattggagaccccaacctggagtttgttgccatgcctgct ctcgccccgccagaggtggtcatggacccggcattggcagcgcagtatgagcacgaccta gaggttgctcagacgaccgccctcccggatgaggacgacgacctgtga

DBGET integrated database retrieval system