Ochotona princeps (American pika): 101530066 Help Entry 101530066         CDS       T07609                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism opi  Ochotona princeps (American pika) Pathway opi01523   Antifolate resistance opi04010   MAPK signaling pathway opi04014   Ras signaling pathway opi04024   cAMP signaling pathway opi04062   Chemokine signaling pathway opi04064   NF-kappa B signaling pathway opi04066   HIF-1 signaling pathway opi04071   Sphingolipid signaling pathway opi04137   Mitophagy - animal opi04151   PI3K-Akt signaling pathway opi04210   Apoptosis opi04211   Longevity regulating pathway opi04218   Cellular senescence opi04380   Osteoclast differentiation opi04613   Neutrophil extracellular trap formation opi04620   Toll-like receptor signaling pathway opi04621   NOD-like receptor signaling pathway opi04622   RIG-I-like receptor signaling pathway opi04623   Cytosolic DNA-sensing pathway opi04625   C-type lectin receptor signaling pathway opi04657   IL-17 signaling pathway opi04658   Th1 and Th2 cell differentiation opi04659   Th17 cell differentiation opi04660   T cell receptor signaling pathway opi04662   B cell receptor signaling pathway opi04668   TNF signaling pathway opi04722   Neurotrophin signaling pathway opi04917   Prolactin signaling pathway opi04920   Adipocytokine signaling pathway opi04926   Relaxin signaling pathway opi04931   Insulin resistance opi04932   Non-alcoholic fatty liver disease opi04933   AGE-RAGE signaling pathway in diabetic complications opi04936   Alcoholic liver disease opi05010   Alzheimer disease opi05022   Pathways of neurodegeneration - multiple diseases opi05030   Cocaine addiction opi05132   Salmonella infection opi05133   Pertussis opi05134   Legionellosis opi05135   Yersinia infection opi05140   Leishmaniasis opi05142   Chagas disease opi05145   Toxoplasmosis opi05146   Amoebiasis opi05152   Tuberculosis opi05160   Hepatitis C opi05161   Hepatitis B opi05162   Measles opi05163   Human cytomegalovirus infection opi05164   Influenza A opi05165   Human papillomavirus infection opi05166   Human T-cell leukemia virus 1 infection opi05167   Kaposi sarcoma-associated herpesvirus infection opi05168   Herpes simplex virus 1 infection opi05169   Epstein-Barr virus infection opi05170   Human immunodeficiency virus 1 infection opi05171   Coronavirus disease - COVID-19 opi05200   Pathways in cancer opi05202   Transcriptional misregulation in cancer opi05203   Viral carcinogenesis opi05207   Chemical carcinogenesis - receptor activation opi05208   Chemical carcinogenesis - reactive oxygen species opi05212   Pancreatic cancer opi05215   Prostate cancer opi05220   Chronic myeloid leukemia opi05221   Acute myeloid leukemia opi05222   Small cell lung cancer opi05235   PD-L1 expression and PD-1 checkpoint pathway in cancer opi05321   Inflammatory bowel disease opi05415   Diabetic cardiomyopathy opi05417   Lipid and atherosclerosis opi05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101530066 (RELA)    04014 Ras signaling pathway     101530066 (RELA)    04064 NF-kappa B signaling pathway     101530066 (RELA)    04668 TNF signaling pathway     101530066 (RELA)    04066 HIF-1 signaling pathway     101530066 (RELA)    04071 Sphingolipid signaling pathway     101530066 (RELA)    04024 cAMP signaling pathway     101530066 (RELA)    04151 PI3K-Akt signaling pathway     101530066 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     101530066 (RELA)   09143 Cell growth and death    04210 Apoptosis     101530066 (RELA)    04218 Cellular senescence     101530066 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101530066 (RELA)    04620 Toll-like receptor signaling pathway     101530066 (RELA)    04621 NOD-like receptor signaling pathway     101530066 (RELA)    04622 RIG-I-like receptor signaling pathway     101530066 (RELA)    04623 Cytosolic DNA-sensing pathway     101530066 (RELA)    04625 C-type lectin receptor signaling pathway     101530066 (RELA)    04660 T cell receptor signaling pathway     101530066 (RELA)    04658 Th1 and Th2 cell differentiation     101530066 (RELA)    04659 Th17 cell differentiation     101530066 (RELA)    04657 IL-17 signaling pathway     101530066 (RELA)    04662 B cell receptor signaling pathway     101530066 (RELA)    04062 Chemokine signaling pathway     101530066 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     101530066 (RELA)    04917 Prolactin signaling pathway     101530066 (RELA)    04926 Relaxin signaling pathway     101530066 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     101530066 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     101530066 (RELA)   09149 Aging    04211 Longevity regulating pathway     101530066 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101530066 (RELA)    05202 Transcriptional misregulation in cancer     101530066 (RELA)    05207 Chemical carcinogenesis - receptor activation     101530066 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     101530066 (RELA)    05203 Viral carcinogenesis     101530066 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101530066 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     101530066 (RELA)    05221 Acute myeloid leukemia     101530066 (RELA)    05220 Chronic myeloid leukemia     101530066 (RELA)    05215 Prostate cancer     101530066 (RELA)    05222 Small cell lung cancer     101530066 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101530066 (RELA)    05170 Human immunodeficiency virus 1 infection     101530066 (RELA)    05161 Hepatitis B     101530066 (RELA)    05160 Hepatitis C     101530066 (RELA)    05171 Coronavirus disease - COVID-19     101530066 (RELA)    05164 Influenza A     101530066 (RELA)    05162 Measles     101530066 (RELA)    05168 Herpes simplex virus 1 infection     101530066 (RELA)    05163 Human cytomegalovirus infection     101530066 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     101530066 (RELA)    05169 Epstein-Barr virus infection     101530066 (RELA)    05165 Human papillomavirus infection     101530066 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     101530066 (RELA)    05135 Yersinia infection     101530066 (RELA)    05133 Pertussis     101530066 (RELA)    05134 Legionellosis     101530066 (RELA)    05152 Tuberculosis     101530066 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     101530066 (RELA)    05145 Toxoplasmosis     101530066 (RELA)    05140 Leishmaniasis     101530066 (RELA)    05142 Chagas disease     101530066 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     101530066 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     101530066 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     101530066 (RELA)   09165 Substance dependence    05030 Cocaine addiction     101530066 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101530066 (RELA)    05418 Fluid shear stress and atherosclerosis     101530066 (RELA)    05415 Diabetic cardiomyopathy     101530066 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101530066 (RELA)    04932 Non-alcoholic fatty liver disease     101530066 (RELA)    04931 Insulin resistance     101530066 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     101530066 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     101530066 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:opi03000]     101530066 (RELA) Transcription factors [BR:opi03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     101530066 (RELA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  101530066 NCBI-ProteinID:  XP_036349005 LinkDB All DBs Position 1:109818857..109825531 Genome browser AA seq 614 aa AA seqDB search MGVFGVVHLVRHRRLAAGMRLGGGGSGLSPGAPPAAISPQVLTQFPREGRPGWPLTPCLL PLSELFPLIFSSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHP TIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQ CVKKRDLEQAINQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVL SHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSF SQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDREVSEPMEFQYLPDTDDRHRIE EKRKRTYETFKSIMKKSPFNGPTDPRPAPRRIAVPARSSPSVPKPAPQPYPFMTPLSTIN FEEFSPMAFPPGPIPSQAPALAPAPVSAPAPAMASALPPASTPAPAPTPAPVLVLAPGPA PAAAPPAPRNTQAGEGTLSEALLHLQFDADEDLGALLGNSTDSGGLTDLASVDNSEFQQL LSQGVPMASHVAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLSNGLLAGDEDFSSI ADMDFSALLSQISS NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt atgggagtgttcggggtcgtgcacctggtgcgacacaggcgcctggctgcagggatgagg ctggggggcggggggagcggcttatccccgggcgccccgccagccgccatttcaccgcag gtcctgactcagtttccccgggaggggagacctgggtggccactgactccttgtctcctc cccctttcagaactgtttcccctcatcttctcttcagagccagcccaggcctccggcccc tatgtggagatcatcgaacagcccaagcagcgcgggatgcgcttccgctacaagtgtgag ggccgctcagcgggcagcatccccggcgagaggagcactgacactaccaagactcacccc accatcaagatcaatggctacacagggccagggacagttcgcatctccctggtgaccaag gacccccctcaccggcctcacccccacgagctggtggggaaggactgccgcgatggcttc tatgaggctgagctctgtcctgaccgctgcatccacagcttccagaacctggggatccag tgtgtgaaaaaacgcgacctggaacaggccatcaaccagcgcatccagaccaacaacaac cccttccaagtgcccatagaggagcagcgtggggactacgacctgaacgccgtgaggctc tgcttccaggtcacagtacgtgacccctcgggcaggcccctccgcctgccgcccgtcctc tcacatcccatctttgacaaccgcgcccccaacactgctgagctcaagatctgccgagtg aaccgcaactctgggagctgcctgggtggggatgagatcttcctgctgtgcgacaaggtg cagaaagaggacattgaggtgtacttcacggggccgggctgggaggcccggggctccttc tcgcaagctgacgtgcaccggcaggtggccatcgtgttccggacccctccatacgcggac cccagcctgcaggcacccgtgcgcgtctccatgcagttgcggcggccttccgaccgggag gtcagcgagcccatggagttccaataccttcccgacacagatgaccgtcaccgcattgag gagaaacgcaaaagaacatatgagaccttcaagagcatcatgaagaaaagccctttcaat gggcccaccgacccacgacctgctccccggcgcattgctgtgcctgctcgcagctcgcct tccgttcccaagcctgccccccagccctatccctttatgacacccctcagcaccatcaac tttgaggaattctcccccatggcatttcctccggggccgatcccgagccaggccccagcc ttggcaccagctcctgtgtctgcacctgccccagccatggcttcagctctgcccccagcc tccaccccagcccctgcccccacccccgcccccgtcttggtcctggcccccggccctgcg ccagcagcagccccgcctgcccccaggaacacccaggccggggaaggcacactgtccgag gccctgctgcacctgcagtttgatgctgatgaagacctgggggccctgctgggcaacagc acagactcaggagggctcacagacctggcgtccgtcgacaactcggagttccagcagctg ctgagccagggcgtgcccatggcctcgcatgtggccgagcccatgctcatggagtaccca gaggccatcactcgcctggtgaccgggtcccagagaccacccgacccagcgcctgcaccc ctgggggcctcggggctctccaatggcctcctggcgggggacgaagacttctcctccatc gcggacatggacttctcggctcttctgagtcagatcagctcctaa

DBGET integrated database retrieval system